Відкрити головне меню

CD151 (англ. CD151 molecule (Raph blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 253 амінокислот, а молекулярна маса — 28 295[4].

CD151
Ідентифікатори
Символи CD151, GP27, MER2, PETA-3, RAPH, SFA1, TSPAN24, CD151 molecule (Raph blood group)
Зовнішні ІД OMIM: 602243 MGI: 1096360 HomoloGene: 20916 GeneCards: CD151
Шаблон експресії
PBB GE CD151 204306 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_139030
NM_001039490
NM_004357
NM_139029
NM_001111049
NM_001111050
NM_009842
RefSeq (білок)
NP_001104519
NP_001104520
NP_033972
Локус (UCSC) Хр. 11: 0.83 – 0.84 Mb Хр. 7: 141.47 – 141.47 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYIS
LLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLII
FLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQ
QEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASN
IYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKL
EHY

Локалізований у мембрані.

ЛітератураРедагувати

  • Whittock N.V., McLean W.H.I. (2001). Genomic organization, amplification, fine mapping, and intragenic polymorphisms of the human hemidesmosomal tetraspanin CD151 gene.. Biochem. Biophys. Res. Commun. 281: 425 — 430.  PubMed DOI:10.1006/bbrc.2001.4384
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Scheffer K.D., Berditchevski F., Florin L. (2014). The tetraspanin CD151 in papillomavirus infection.. Viruses 6: 893 — 908.  PubMed DOI:10.3390/v6020893
  • Fitter S., Tetaz T.J., Berndt M.C., Ashman L.K. (1995). Molecular cloning of cDNA encoding a novel platelet-endothelial cell tetra-span antigen, PETA-3.. Blood 86: 1348 — 1355.  PubMed
  • Hasegawa H., Utsunomiya Y., Kishimoto K., Yanagisawa K., Fujita S. (1996). SFA-1, a novel cellular gene induced by human T-cell leukemia virus type 1, is a member of the transmembrane 4 superfamily.. J. Virol. 70: 3258 — 3263.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1630 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P48509 (англ.). Процитовано 8 вересня 2017. 

Див. такожРедагувати