Відкрити головне меню

C4A (англ. Complement C4A (Rodgers blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 744 амінокислот, а молекулярна маса — 192 785[4].

C4A
Protein C4A PDB 1hzf.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C4A, C4, C4A2, C4A3, C4A4, C4A6, C4AD, C4S, CO4, CPAMD2, RG, complement component 4A (Rodgers blood group), complement C4A (Rodgers blood group)
Зовнішні ІД MGI: 88228 HomoloGene: 36030 GeneCards: C4A
Шаблон експресії
PBB GE C4A 214428 x at fs.png

PBB GE C4A 208451 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001252204
NM_007293
NM_009780
RefSeq (білок)
NP_001239133
NP_009224
NP_033910
Локус (UCSC) Хр. 6: 31.98 – 32 Mb Хр. 17: 34.73 – 34.74 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQ
VVKGSVFLRNPSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLH
QLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGHLFLQTDQPIY
NPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYMPSSIFQD
DFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKP
YILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGG
EMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASG
IPVKVSATVSSPGSVPEVQDIQQNTDGSGQVSIPIIIPQTISELQLSVSA
GSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLNLNLRAVGSGA
TFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAFYYHG
DHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAA
GLAFSDGDQWTLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAK
RCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKG
QAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLP
DSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLE
LRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNP
LDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGV
ASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQ
KGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKL
QETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALH
HGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYAL
TLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNP
SDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFR
STQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQ
IRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIE
VTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEGRRNR
RRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQ
PASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRR
ALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQV
LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQ
YLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, шлях активації комплементу, запальна відповідь, альтернативний сплайсинг. Локалізований у клітинних контактах, клітинних відростках, синапсах. Також секретований назовні.

ЛітератураРедагувати

  • Belt K.T., Carroll M.C., Porter R.R. (1984). The structural basis of the multiple forms of human complement component C4.. Cell 36: 907 — 914.  PubMed DOI:10.1016/0092-8674(84)90040-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Belt K.T., Yu C.Y., Carroll M.C., Porter R.R. (1985). Polymorphism of human complement component C4.. Immunogenetics 21: 173 — 180.  PubMed DOI:10.1007/BF00364869
  • Hessing M., van 't Veer C., Hackeng T.M., Bouma B.N., Iwanaga S. (1990). Importance of the alpha 3-fragment of complement C4 for the binding with C4b-binding protein.. FEBS Lett. 271: 131 — 136.  PubMed DOI:10.1016/0014-5793(90)80389-Z
  • Campbell R.D., Gagnon J., Porter R.R. (1981). Amino acid sequence around the thiol and reactive acyl groups of human complement component C4.. Biochem. J. 199: 359 — 370.  PubMed DOI:10.1042/bj1990359
  • Chakravarti D.N., Campbell R.D., Porter R.R. (1987). The chemical structure of the C4d fragment of the human complement component C4.. Mol. Immunol. 24: 1187 — 1197.  PubMed DOI:10.1016/0161-5890(87)90165-9

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1323 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, P0C0L4 (англ.). Процитовано 6 вересня 2017. 

Див. такожРедагувати