BMP2

білок-кодуючий ген Homo Sapiens

BMP2 (англ. Bone morphogenetic protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 396 амінокислот, а молекулярна маса — 44 702[5].

BMP2
BMP2.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BMP2, BDA2, BMP2A, bone morphogenetic protein 2, SSFSC, SSFSC1
Зовнішні ІД OMIM: 112261 MGI: 88177 HomoloGene: 926 GeneCards: BMP2
Пов'язані генетичні захворювання
ожиріння, brachydactyly type A2[1]
Шаблон експресії
PBB GE BMP2 205290 s at fs.png

PBB GE BMP2 205289 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001200
NM_007553
RefSeq (білок)
NP_001191
NP_031579
Локус (UCSC) Хр. 20: 6.77 – 6.78 Mb Хр. 2: 133.55 – 133.56 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVL
SEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLE
RAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAEL
QVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQN
ASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSL
HQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVN
SVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR

Кодований геном білок за функціями належить до цитокінів, факторів росту, білків розвитку. Задіяний у таких біологічних процесах, як остеогенез, диференціація клітин. Секретований назовні.

ЛітератураРедагувати

  • Yeung B., Porter T.J., Vath J.E. (1997). Direct isoform analysis of high-mannose-containing glycoproteins by on-line capillary electrophoresis electrospray mass spectrometry.. Anal. Chem. 69: 2510 — 2516.  PubMed DOI:10.1021/ac9611172
  • Scheufler C., Sebald W., Huelsmeyer M. (1999). Crystal structure of human bone morphogenetic protein-2 at 2.7 A resolution.. J. Mol. Biol. 287: 103 — 115.  PubMed DOI:10.1006/jmbi.1999.2590

ПриміткиРедагувати

Див. такожРедагувати