Відкрити головне меню

ARTN (англ. Artemin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 220 амінокислот, а молекулярна маса — 22 878[4].

ARTN
Artemin Tertiary Structure.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARTN, ENOVIN, EVN, NBN, artemin, ART
Зовнішні ІД OMIM: 603886 MGI: 1333791 HomoloGene: 7631 GeneCards: ARTN
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001136215
NM_003976
NM_057090
NM_057091
NM_057160
NM_009711
NM_001284191
NM_001284192
NM_001284193
RefSeq (білок)
NP_001129687
NP_476431
NP_476432
NP_001271120
NP_001271121
NP_001271122
NP_033841
Локус (UCSC) Хр. 1: 43.93 – 43.94 Mb Хр. 4: 117.93 – 117.93 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAP
REGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALP
RGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFC
SGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMD
VNSTWRTVDRLSATACGCLG

Кодований геном білок за функцією належить до факторів росту. Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wang X., Baloh R.H., Milbrandt J., Garcia K.C. (2006). Structure of artemin complexed with its receptor GFRalpha3: convergent recognition of glial cell line-derived neurotrophic factors.. Structure 14: 1083 — 1092.  PubMed DOI:10.1016/j.str.2006.05.010

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:727 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q5T4W7 (англ.). Процитовано 25 серпня 2017. 

Див. такожРедагувати