Відкрити головне меню

ANPEP (англ. Alanyl aminopeptidase, membrane) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 967 амінокислот, а молекулярна маса — 109 540[4].

ANPEP
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ANPEP, APN, CD13, GP150, LAP1, P150, PEPN, alanyl aminopeptidase, membrane
Зовнішні ІД OMIM: 151530 MGI: 5000466 HomoloGene: 68163 GeneCards: ANPEP
Шаблон експресії
PBB GE ANPEP 202888 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001150
NM_008486
RefSeq (білок)
NP_001141
NP_032512
Локус (UCSC) Хр. 15: 89.78 – 89.82 Mb Хр. 7: 79.82 – 79.86 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTT
PSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGL
YVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDI
DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYME
GNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNML
PKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFN
AGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVT
IEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALA
SSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGL
ASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFP
VITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDH
SAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALS
SLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQ
YSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNA
IAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWILNRYLSYTLN
PDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKW
VKENKEVVLQWFTENSK

Кодований геном білок за функціями належить до гідролаз, протеаз, рецепторів клітини-хазяїна для входу віруса, рецепторів, білків розвитку, амінопептидаз, металопротеаз. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, ангіогенез, диференціація клітин. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Look A.T., Ashmun R.A., Shapiro L.H., Peiper S.C. (1989). Human myeloid plasma membrane glycoprotein CD13 (gp150) is identical to aminopeptidase N.. J. Clin. Invest. 83: 1299 — 1307.  PubMed DOI:10.1172/JCI114015
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Watanabe Y., Iwaki-Egawa S., Mizukoshi H., Fujimoto Y. (1995). Identification of an alanine aminopeptidase in human maternal serum as a membrane-bound aminopeptidase N.. Biol. Chem. Hoppe-Seyler 376: 397 — 400.  PubMed DOI:10.1515/bchm3.1995.376.7.397
  • Kolb A.F., Maile J., Heister A., Siddell S.G. (1996). Characterization of functional domains in the human coronavirus HCV 229E receptor.. J. Gen. Virol. 77: 2515 — 2521.  PubMed DOI:10.1099/0022-1317-77-10-2515
  • Seli E., Senturk L.M., Bahtiyar O.M., Kayisli U.A., Arici A. (2001). Expression of aminopeptidase N in human endometrium and regulation of its activity by estrogen.. Fertil. Steril. 75: 1172 — 1176.  PubMed DOI:10.1016/S0015-0282(01)01779-4
  • Wentworth D.E., Holmes K.V. (2001). Molecular determinants of species specificity in the coronavirus receptor aminopeptidase N (CD13): influence of N-linked glycosylation.. J. Virol. 75: 9741 — 9752.  PubMed DOI:10.1128/JVI.75.20.9741-9752.2001

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:500 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P15144 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати