Аденозилгомоцистеїназа

білок-кодуючий ген Homo Sapiens
(Перенаправлено з AHCY)

Аденозилгомоцистеїназа (англ. Adenosylhomocysteinase) – білок, який кодується геном AHCY, розташованим у людей на короткому плечі 20-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 432 амінокислот, а молекулярна маса — 47 716[5].

Аденозилгомоцистеїназа
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи AHCY, adenosylhomocysteinase, SAHH, adoHcyase, Adenosylhomocysteinase
Зовнішні ІД OMIM: 180960 MGI: 87968 HomoloGene: 554 GeneCards: AHCY
Пов'язані генетичні захворювання
hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016661
RefSeq (білок)
NP_057870
Локус (UCSC) Хр. 20: 34.28 – 34.31 Mb Хр. 2: 154.9 – 154.92 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARI
AGCLHMTVETAVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVY
AWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGI
RGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLI
DGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINAL
QAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCA
MGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
KLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY

Цей білок за функцією належить до гідролаз. Задіяний у такому біологічному процесі як одновуглецевий метаболізм. Білок має сайт для зв'язування з НАД. Локалізований у цитоплазмі.

Література ред.

  • Coulter-Karis D.E., Hershfield M.S. (1989). Sequence of full length cDNA for human S-adenosylhomocysteine hydrolase. Ann. Hum. Genet. 53: 169—175. PMID 2596825 DOI:10.1111/j.1469-1809.1989.tb01781.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Gupta R.A., Yuan C.-S., Ault-Riche D.B., Borchardt R.T. (1995). Limited proteolysis of S-adenosylhomocysteine hydrolase: implications for the three-dimensional structure. Arch. Biochem. Biophys. 319: 365—371. PMID 7786017 DOI:10.1006/abbi.1995.1306
  • Arredondo-Vega F.X., Charlton J.A., Edwards Y.H., Hopkinson D.A., Whitehouse D.B. (1989). Isozyme and DNA analysis of human S-adenosyl-L-homocysteine hydrolase (AHCY). Ann. Hum. Genet. 53: 157—167. PMID 2574561 DOI:10.1111/j.1469-1809.1989.tb01780.x
  • Yuan C.S., Borchardt R.T. (1995). Photoaffinity labeling of human placental S-adenosylhomocysteine hydrolase with [2-3H]8-azido-adenosine. J. Biol. Chem. 270: 16140—16146. PMID 7608178 DOI:10.1074/jbc.270.27.16140
  • Gellekink H., den Heijer M., Kluijtmans L.A., Blom H.J. (2004). Effect of genetic variation in the human S-adenosylhomocysteine hydrolase gene on total homocysteine concentrations and risk of recurrent venous thrombosis. Eur. J. Hum. Genet. 12: 942—948. PMID 15241484 DOI:10.1038/sj.ejhg.5201237

Примітки ред.

Див. також ред.