Відкрити головне меню

ACKR1 (англ. Atypical chemokine receptor 1 (Duffy blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 336 амінокислот, а молекулярна маса — 35 553[4].

ACKR1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACKR1, atypical chemokine receptor 1 (Duffy blood group), CCBP1, CD234, Dfy, FY, GPD, GpFy, WBCQ1, DARC, DARC/ACKR1
Зовнішні ІД OMIM: 613665 MGI: 1097689 HomoloGene: 48067 GeneCards: ACKR1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002036
NM_001122951
NM_010045
RefSeq (білок)
NP_001116423
NP_002027
NP_034175
Локус (UCSC) Хр. 1: 159.2 – 159.21 Mb Хр. 1: 173.33 – 173.33 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAP
CHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLA
QLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCH
ASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYS
TELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWF
IFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT
PLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у мембрані, ендосомах.

ЛітератураРедагувати

  • Tournamille C., Colin Y., Cartron J.-P., Le van Kim C. (1995). Disruption of a GATA motif in the Duffy gene promoter abolishes erythroid gene expression in Duffy-negative individuals.. Nat. Genet. 10: 224 — 228.  PubMed DOI:10.1038/ng0695-224
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bonecchi R., Savino B., Borroni E.M., Mantovani A., Locati M. (2010). Chemokine decoy receptors: structure-function and biological properties.. Curr. Top. Microbiol. Immunol. 341: 15 — 36.  PubMed DOI:10.1007/82_2010_19
  • Novitzky-Basso I., Rot A. (2012). Duffy antigen receptor for chemokines and its involvement in patterning and control of inflammatory chemokines.. Front. Immunol. 3: 266 — 266.  PubMed DOI:10.3389/fimmu.2012.00266
  • Graham G.J., Locati M., Mantovani A., Rot A., Thelen M. (2012). The biochemistry and biology of the atypical chemokine receptors.. Immunol. Lett. 145: 30 — 38.  PubMed DOI:10.1016/j.imlet.2012.04.004
  • Cancellieri C., Vacchini A., Locati M., Bonecchi R., Borroni E.M. (2013). Atypical chemokine receptors: from silence to sound.. Biochem. Soc. Trans. 41: 231 — 236.  PubMed DOI:10.1042/BST20120246

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4035 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q16570 (англ.). Процитовано 25 серпня 2017. 

Див. такожРедагувати