Відкрити головне меню

ABCB6 (англ. ATP binding cassette subfamily B member 6 (Langereis blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 842 амінокислот, а молекулярна маса — 93 886[4].

ABCB6
Protein ABCB6 PDB 3NH6.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ABCB6, ABC, ABC14, DUH3, LAN, MCOPCB7, MTABC3, PRP, umat, PSHK2, ATP binding cassette subfamily B member 6 (Langereis blood group)
Зовнішні ІД MGI: 1921354 HomoloGene: 11375 GeneCards: ABCB6
Шаблон експресії
PBB GE ABCB6 203192 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005689
NM_001349828
NM_023732
RefSeq (білок)
NP_005680
NP_001336757
NP_076221
Локус (UCSC) Хр. 2: 219.21 – 219.22 Mb Хр. 1: 75.17 – 75.18 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVTVGNYCEAEGPVGPAWMQDGLSPCFFFTLVPSTRMALGTLALVLALPC
RRRERPAGADSLSWGAGPRISPYVLQLLLATLQAALPLAGLAGRVGTARG
APLPSYLLLASVLESLAGACGLWLLVVERSQARQRLAMGIWIKFRHSPGL
LLLWTVAFAAENLALVSWNSPQWWWARADLGQQVQFSLWVLRYVVSGGLF
VLGLWAPGLRPQSYTLQVHEEDQDVERSQVRSAAQQSTWRDFGRKLRLLS
GYLWPRGSPALQLVVLICLGLMGLERALNVLVPIFYRNIVNLLTEKAPWN
SLAWTVTSYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRRVELLIF
SHLHELSLRWHLGRRTGEVLRIADRGTSSVTGLLSYLVFNVIPTLADIII
GIIYFSMFFNAWFGLIVFLCMSLYLTLTIVVTEWRTKFRRAMNTQENATR
ARAVDSLLNFETVKYYNAESYEVERYREAIIKYQGLEWKSSASLVLLNQT
QNLVIGLGLLAGSLLCAYFVTEQKLQVGDYVLFGTYIIQLYMPLNWFGTY
YRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYA
DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISSGCIRID
GQDISQVTQASLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAA
QAAGIHDAIMAFPEGYRTQVGERGLKLSGGEKQRVAIARTILKAPGIILL
DEATSALDTSNERAIQASLAKVCANRTTIVVAHRLSTVVNADQILVIKDG
CIVERGRHEALLSRGGVYADMWQLQQGQEETSEDTKPQTMER

Задіяний у таких біологічних процесах як транспорт, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у клітинній мембрані, мембрані, мітохондрії, ендоплазматичному ретикулумі, зовнішній мембрані мітохондрій, апараті гольджі, ендосомах.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tsuchida M., Emi Y., Kida Y., Sakaguchi M. (2008). Human ABC transporter isoform B6 (ABCB6) localizes primarily in the Golgi apparatus.. Biochem. Biophys. Res. Commun. 369: 369 — 375.  PubMed DOI:10.1016/j.bbrc.2008.02.027
  • Haffke M., Menzel A., Carius Y., Jahn D., Heinz D.W. (2010). Structures of the nucleotide-binding domain of the human ABCB6 transporter and its complexes with nucleotides.. Acta Crystallogr. D 66: 979 — 987.  PubMed DOI:10.1107/S0907444910028593

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:47 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9NP58 (англ.). Процитовано 28 серпня 2017. 

Див. такожРедагувати