Фенілаланінгідроксилаза

Фенілаланінгідроксилаза (англ. Phenylalanine hydroxylase, PAH) — білок, який кодується геном PAH, розташованим у людей на короткому плечі 12-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 452 амінокислот, а молекулярна маса — 51 862[6].

PAH
Phenylalanine hydroxylase.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PAH, PH, PKU, PKU1, phenylalanine hydroxylase
Зовнішні ІД OMIM: 612349 MGI: 97473 HomoloGene: 234 GeneCards: PAH
Пов'язані генетичні захворювання
фенілкетонурія[1]
Реагує на сполуку
fenclonine[2]
Шаблон експресії
PBB GE PAH 205719 s at fs.png

PBB GE PAH 217583 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000277
NM_001354304
NM_008777
RefSeq (білок)
NP_000268
NP_001341233
NP_032803
Локус (UCSC) Хр. 12: 102.84 – 102.96 Mb Хр. 10: 87.36 – 87.42 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAK
VLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRH
DIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFK
DPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKT
HACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLS
SRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSS
FGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVR
NFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQK
IK

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Білок має сайт для зв'язування з іоном заліза.

Фермент додає гідроксильну групу до молекули фенілаланіну, утворюючи іншу амінокислоту — тирозин. У випадку дефекту роботи ферменту розвивається захворювання фенілкетонурія, зазвичай спадкове.

ЛітератураРедагувати

  • Kwok S.C.M., Ledley F.D., Dilella A.G., Robson K.J.H., Woo S.L.C. (1985). Nucleotide sequence of a full-length complementary DNA clone and amino acid sequence of human phenylalanine hydroxylase.. Biochemistry 24: 556 — 561.  PubMed DOI:10.1021/bi00324a002
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cotton R.G., McAdam W., Jennings I., Morgan F.J. (1988). A monoclonal antibody to aromatic amino acid hydroxylases. Identification of the epitope.. Biochem. J. 255: 193 — 196.  PubMed DOI:10.1042/bj2550193
  • Siltberg-Liberles J., Steen I.H., Svebak R.M., Martinez A. (2008). The phylogeny of the aromatic amino acid hydroxylases revisited by characterizing phenylalanine hydroxylase from Dictyostelium discoideum.. Gene 427: 86 — 92.  PubMed DOI:10.1016/j.gene.2008.09.005
  • Erlandsen H., Flatmark T., Stevens R.C., Hough E. (1998). Crystallographic analysis of the human phenylalanine hydroxylase catalytic domain with bound catechol inhibitors at 2.0-A resolution.. Biochemistry 37: 15638 — 15646.  PubMed DOI:10.1021/bi9815290
  • Fusetti F., Erlandsen H., Flatmark T., Stevens R.C. (1998). Structure of tetrameric human phenylalanine hydroxylase and its implications for phenylketonuria.. J. Biol. Chem. 273: 16962 — 16967.  PubMed DOI:10.1074/jbc.273.27.16962

ПриміткиРедагувати

Див. такожРедагувати