Відкрити головне меню

Тромбоспондин-1 (англ. Thrombospondin 1) – білок, який кодується геном THBS1, розташованим у людей на короткому плечі 15-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 170 амінокислот, а молекулярна маса — 129 383[4].

Тромбоспондин-1
Protein THBS1 PDB 1lsl.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи THBS1, THBS, THBS-1, TSP, TSP-1, TSP1, thrombospondin 1
Зовнішні ІД OMIM: 188060 MGI: 98737 HomoloGene: 31142 GeneCards: THBS1
Шаблон експресії
PBB GE THBS1 201108 s at fs.png

PBB GE THBS1 201110 s at fs.png

PBB GE THBS1 201107 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003246
NM_011580
NM_001313914
RefSeq (білок)
NP_003237
н/д
Локус (UCSC) Хр. 15: 39.58 – 39.6 Mb Хр. 2: 118.11 – 118.13 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVK
GPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKT
RGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLAT
GQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIA
KGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS
SPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKK
VSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQ
QRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVT
CGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSP
WDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDG
CLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPC
TDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPN
ENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDD
RDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAAD
IDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSD
RIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENV
DISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGY
DEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDT
NPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHI
GWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGL
FVFSQEMVFFSDLKYECRDP

Задіяний у таких біологічних процесах як клітинна адгезія, відповідь на порушення конформації білку. Білок має сайт для зв'язування з іоном кальцію, з молекулою гепарину. Локалізований у ендоплазматичному ретикулумі, саркоплазматичному ретикулумі.

ЛітератураРедагувати

  • Lawler J., Hynes R.O. (1986). The structure of human thrombospondin, an adhesive glycoprotein with multiple calcium-binding sites and homologies with several different proteins.. J. Cell Biol. 103: 1635 — 1648.  PubMed DOI:10.1083/jcb.103.5.1635
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kobayashi S., Eden-Mccutchan F., Framson P., Bornstein P. (1986). Partial amino acid sequence of human thrombospondin as determined by analysis of cDNA clones: homology to malarial circumsporozoite proteins.. Biochemistry 25: 8418 — 8425.  PubMed DOI:10.1021/bi00374a014
  • Dixit V.M., Hennessy S.W., Grant G.A., Rotwein P., Frazier W.A. (1986). Characterization of a cDNA encoding the heparin and collagen binding domains of human thrombospondin.. Proc. Natl. Acad. Sci. U.S.A. 83: 5449 — 5453.  PubMed DOI:10.1073/pnas.83.15.5449
  • Asch A.S., Silbiger S., Heimer E., Nachman R.L. (1992). Thrombospondin sequence motif (CSVTCG) is responsible for CD36 binding.. Biochem. Biophys. Res. Commun. 182: 1208 — 1217.  PubMed DOI:10.1016/0006-291X(92)91860-S
  • Huwiler K.G., Vestling M.M., Annis D.S., Mosher D.F. (2002). Biophysical characterization, including disulfide bond assignments, of the anti-angiogenic type 1 domains of human thrombospondin-1.. Biochemistry 41: 14329 — 14339.  PubMed DOI:10.1021/bi026463u

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11785 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P07996 (англ.). Процитовано 30 січня 2017. 

Див. такожРедагувати