Відкрити головне меню

Трансальдолаза-1 (англ. Transaldolase 1) – білок, який кодується геном TALDO1, розташованим у людей на короткому плечі 11-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 337 амінокислот, а молекулярна маса — 37 540[4].

Трансальдолаза-1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TALDO1, TAL, TAL-H, TALDOR, TALH, transaldolase 1
Зовнішні ІД MGI: 1274789 HomoloGene: 4916 GeneCards: TALDO1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006755
NM_011528
RefSeq (білок)
NP_006746
NP_035658
Локус (UCSC) Хр. 11: 0.75 – 0.77 Mb Хр. 7: 141.39 – 141.4 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLIL
AAAQMPAYQELVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIP
GRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGI
QAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVAN
TDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGC
DFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNE
DQMAVEKLSDGIRKFAADAVKLERMLTERMFNAENGK

Цей білок за функцією належить до трансфераз. Задіяний у такому біологічному процесі як пентозне шунтування. Білок має сайт для зв'язування з шиффовими основами. Локалізований у цитоплазмі.

ЛітератураРедагувати

  • Perl A., Colombo E., Samoilova E., Butler M.C., Banki K. (2000). Human transaldolase-associated repetitive elements are transcribed by RNA polymerase III.. J. Biol. Chem. 275: 7261 — 7272.  PubMed DOI:10.1074/jbc.275.10.7261
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Thorell S., Gergely P. Jr., Banki K., Perl A., Schneider G. (2000). The three-dimensional structure of human transaldolase.. FEBS Lett. 475: 205 — 208.  PubMed DOI:10.1016/S0014-5793(00)01658-6
  • Banki K., Halladay D.L., Perl A. (1994). Cloning and expression of the human gene for transaldolase. A novel highly repetitive element constitutes an integral part of the coding sequence.. J. Biol. Chem. 269: 2847 — 2851.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11559 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P37837 (англ.). Процитовано 30 січня 2017. 

Див. такожРедагувати