Відкрити головне меню

Тирозингідроксилаза

білок-кодуючий ген Homo Sapiens

TH (англ. Tyrosine hydroxylase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 528 амінокислот, а молекулярна маса — 58 600[5].

TH
Tyrosine hydroxylase showing all four subunits.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TH, Th, DYT14, DYT5b, TYH, tyrosine hydroxylase, Tyrosine hydroxylase
Зовнішні ІД OMIM: 191290 MGI: 98735 HomoloGene: 307 GeneCards: TH
Реагує на сполуку
3-iodo-DL-tyrosine, racemetirosine[1]
Шаблон експресії
PBB GE TH 208291 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000360
NM_199292
NM_199293
NM_009377
RefSeq (білок)
NP_000351
NP_954986
NP_954987
NP_954986.2
NP_954987.2
NP_033403
Локус (UCSC) Хр. 11: 2.16 – 2.17 Mb Хр. 7: 142.89 – 142.93 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTA
APAASYTPTPRSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLE
AVAFEEKEGKAVLNLLFSPRATKPSALSRAVKVFETFEAKIHHLETRPAQ
RPRAGGPHLEYFVRLEVRRGDLAALLSGVRQVSEDVRSPAGPKVPWFPRK
VSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPI
PRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNI
PQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASS
PMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTL
YWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAV
QPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVL
DSPQAVRRSLEGVQDELDTLAHALSAIG

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном заліза.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Luedecke B., Dworniczak B., Bartholome K. (1995). A point mutation in the tyrosine hydroxylase gene associated with Segawa's syndrome.. Hum. Genet. 95: 123 — 125.  PubMed DOI:10.1007/BF00225091
  • Luedecke B., Bartholome K. (1995). Frequent sequence variant in the human tyrosine hydroxylase gene.. Hum. Genet. 95: 716 — 716.  PubMed DOI:10.1007/BF00209496
  • Knappskog P.M., Flatmark T., Mallet J., Luedecke B., Bartholome K. (1995). Recessively inherited L-DOPA-responsive dystonia caused by a point mutation (Q381K) in the tyrosine hydroxylase gene.. Hum. Mol. Genet. 4: 1209 — 1212.  PubMed DOI:10.1093/hmg/4.7.1209
  • Schiller A., Wevers R.A., Steenbergen G.C., Blau N., Jung H.H. (2004). Long-term course of L-dopa-responsive dystonia caused by tyrosine hydroxylase deficiency.. Neurology 63: 1524 — 1526.  PubMed DOI:10.1212/01.WNL.0000142083.47927.0A
  • Haugarvoll K., Bindoff L.A. (2011). A novel compound heterozygous tyrosine hydroxylase mutation (p.R441P) with complex phenotype.. J. Parkinson's Dis. 1: 119 — 122.  PubMed DOI:10.3233/JPD-2011-11006

ПриміткиРедагувати

Див. такожРедагувати