Талін-2

білок-кодуючий ген Homo Sapiens

TLN2 (англ. Talin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 2 542 амінокислот, а молекулярна маса — 271 613[4].

TLN2
Ідентифікатори
Символи TLN2, ILWEQ, talin 2
Зовнішні ІД OMIM: 607349 MGI: 1917799 HomoloGene: 56692 GeneCards: TLN2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015059
NM_001081242
NM_027458
RefSeq (білок)
NP_055874
NP_001074711
Локус (UCSC) Хр. 15: 62.39 – 62.84 Mb Хр. 9: 67.22 – 67.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYG
LFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVK
TVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKD
RTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFF
YSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFG
PHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEV
LQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYID
IILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRTGKAEHGSV
ALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMG
TINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQV
DAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQA
SGDLLRQIGENETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTV
LQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSV
ENCVRACQAATTDSELLKQVSAAASVVSQALHDLLQHVRQFASRGEPIGR
YDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDAEAE
IDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAA
QQQLVQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGS
KMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPM
EIDSALNTVQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAV
GSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGVAASTTDPAAA
HAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAAD
LNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQ
IQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQ
LITLCTQQAPGQKECDNALRELETVKGMLDNPNEPVSDLSYFDCIESVME
NSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVG
ISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDG
DFSEDNRNKCRIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEP
ILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLI
TSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATRDDISVEAL
QEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGV
ASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGT
FVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQ
GQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRE
LIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFA
TAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQ
SSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATK
GAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEAT
IECIKQELTVFQSKDVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQE
DVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLD
LLEHVLVILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPE
DPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQILEAA
KSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQD
SEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQ
IIAAQEEMLKKERELEEARKKLAQIRQQQYKFLPTELREDEG

Кодований геном білок за функцією належить до фосфопротеїнів. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах, синапсах.

ЛітератураРедагувати

  • Monkley S.J., Pritchard C.A., Critchley D.R. (2001). Analysis of the mammalian talin2 gene TLN2.. Biochem. Biophys. Res. Commun. 286: 880 — 885.  PubMed DOI:10.1006/bbrc.2001.5497
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15447 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9Y4G6 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати