Відкрити головне меню

POMC (англ. Proopiomelanocortin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 267 амінокислот, а молекулярна маса — 29 424[2].

Проопіомеланокортин
Ідентифікатори
Символи POMCopiomelanocortin prepropeptidepro-ACTH-endorphinpro-opiomelanocortinproopiomelanocortin preproproteincorticotropin-lipotropin precursorPOMC(1-241)
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE POMC 205720 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRAC
KPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGA
GQKREDVSAGEDCGPLPEGGPEPRSDGAKPGPREGKRSYSMEHFRWGKPV
GKKRRPVKVYPNGAEDESAEAFPLEFKRELTGQRLREGDGPDGPADDGAG
AQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPL
VTLFKNAIIKNAYKKGE

Кодований геном білок за функціями належить до гормонів, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, ацетиляція. Секретований назовні.

ЛітератураРедагувати

  • Takahashi H., Teranishi Y., Nakanishi S., Numa S. (1981). Isolation and structural organization of the human corticotropin-beta-lipotropin precursor gene.. FEBS Lett. 135: 97 — 102.  PubMed DOI:10.1016/0014-5793(81)80952-0
  • Whitfeld P.L., Seeburg P.H., Shine J. (1982). The human pro-opiomelanocortin gene: organization, sequence, and interspersion with repetitive DNA.. DNA 1: 133 — 143.  PubMed DOI:10.1089/dna.1.1982.1.133
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chang A.C.Y., Cochet M., Cohen S.N. (1980). Structural organization of human genomic DNA encoding the pro-opiomelanocortin peptide.. Proc. Natl. Acad. Sci. U.S.A. 77: 4890 — 4894.  PubMed DOI:10.1073/pnas.77.8.4890
  • Seidah N.G., Chretien M. (1981). Complete amino acid sequence of a human pituitary glycopeptide: an important maturation product of pro-opiomelanocortin.. Proc. Natl. Acad. Sci. U.S.A. 78: 4236 — 4240.  PubMed DOI:10.1073/pnas.78.7.4236
  • Seidah N.G., Rochemont J., Hamelin J., Benjannet S., Chretien M. (1981). The missing fragment of the pro-sequence of human pro-opiomelanocortin: sequence and evidence for C-terminal amidation.. Biochem. Biophys. Res. Commun. 102: 710 — 716.  PubMed DOI:10.1016/S0006-291X(81)80190-8

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:9201 (англ.). Процитовано 28 серпня 2017. 
  2. UniProt, P01189 (англ.). Процитовано 28 серпня 2017. 

Див. такожРедагувати