Компонент 6 системи комплементу

Компонент 6 системи комплементу (англ. Complement C6) – білок, який кодується геном C6, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 934 амінокислот, а молекулярна маса — 104 786[4].

Компонент 6 системи комплементу
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи C6, complement C6
Зовнішні ІД OMIM: 217050 MGI: 88233 HomoloGene: 47 GeneCards: C6
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000065
NM_001115131
NM_016704
RefSeq (білок)
NP_000056
NP_001108603
н/д
Локус (UCSC) Хр. 5: 41.14 – 41.26 Mb Хр. 15: 4.73 – 4.81 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQI
VVDKYYQENFCEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQ
SKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADCKNKFRCDSGR
CIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFL
AGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVGFEVQTAEDDL
KTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYN
SALYSRIFDDFGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCV
RIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSE
YGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELAPIVDLVRNIPCA
VTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGE
NCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPP
ENGFIRNEKQLYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQ
RTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGPSRYTCQGNS
WTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDL
CVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERT
RLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA

Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, шлях активації комплементу, цитоліз. Секретований назовні.

ЛітератураРедагувати

  • Hobart M.J., Fernie B., Discipio R.G. (1993). Structure of the human C6 gene.. Biochemistry 32: 6198 — 6205.  PubMed DOI:10.1021/bi00075a012
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chakravarti D.N., Chakravarti B., Parra C.A., Mueller-Eberhard H.J. (1989). Structural homology of complement protein C6 with other channel-forming proteins of complement.. Proc. Natl. Acad. Sci. U.S.A. 86: 2799 — 2803.  PubMed DOI:10.1073/pnas.86.8.2799
  • Lengweiler S., Schaller J., DiScipio R.G., Rickli E.E. (1997). Elucidation of the disulfide-bonding pattern in the factor I modules of the sixth component (C6) of human complement.. Biochim. Biophys. Acta 1342: 13 — 18.  PubMed DOI:10.1016/S0167-4838(97)00072-1
  • Hofsteenge J., Blommers M., Hess D., Furmanek A., Miroshnichenko O. (1999). The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues.. J. Biol. Chem. 274: 32786 — 32794.  PubMed DOI:10.1074/jbc.274.46.32786
  • Dewald G., Nothen M.M., Cichon S. (1993). Polymorphism of human complement component C6: an amino acid substitution (Glu/Ala) within the second thrombospondin repeat differentiates between the two common allotypes C6 A and C6 B.. Biochem. Biophys. Res. Commun. 194: 458 — 464.  PubMed DOI:10.1006/bbrc.1993.1841

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1339 (англ.). Процитовано 27 лютого 2017. 
  4. UniProt, P13671 (англ.). Процитовано 27 лютого 2017. 

Див. такожРедагувати