Відкрити головне меню

Компонент 2 системи комплементу

білок-кодуючий ген Homo Sapiens

C2 (англ. Complement C2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 752 амінокислот, а молекулярна маса — 83 268[5].

C2
Protein C2 PDB 2i6q.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C2, ARMD14, CO2, complement component 2, complement C2
Зовнішні ІД MGI: 88226 HomoloGene: 45 GeneCards: C2
Пов'язані генетичні захворювання
hepatocellular carcinoma[1]
Шаблон експресії
PBB GE C2 203052 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013484
RefSeq (білок)
NP_038512
Локус (UCSC) Хр. 6: 31.9 – 31.95 Mb Хр. 17: 34.86 – 34.9 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYS
CPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIY
TPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGH
CPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGT
EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
GHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
EPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMM
NNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQ
KRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFE
HMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKPKSQETCRGALISDQ
WVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVISPGFDVFAKK
NQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTC
RDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFP
NLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWG
LYNPCLGSADKNSRKRAPRSKVPPPRDFHINLFRMQPWLRQHLGDVLNFL
PL

Кодований геном білок за функціями належить до гідролаз, протеаз, серинових протеаз. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, шлях активації комплементу, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів. Секретований назовні.

ЛітератураРедагувати

  • Bentley D.R. (1986). Primary structure of human complement component C2. Homology to two unrelated protein families.. Biochem. J. 239: 339 — 345.  PubMed DOI:10.1042/bj2390339
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kerr M.A., Gagnon J. (1982). The purification and properties of the second component of guinea-pig complement.. Biochem. J. 205: 59 — 67.  PubMed DOI:10.1042/bj2050059
  • Bentley D.R., Campbell R.D., Cross S.J. (1985). DNA polymorphism of the C2 locus.. Immunogenetics 22: 377 — 390.  PubMed DOI:10.1007/BF00430921
  • Inal J.M., Sim R.B. (2000). A Schistosoma protein, Sh-TOR, is a novel inhibitor of complement which binds human C2.. FEBS Lett. 470: 131 — 134.  PubMed DOI:10.1016/S0014-5793(00)01304-1
  • Gagnon J. (1984). Structure and activation of complement components C2 and factor B.. Philos. Trans. R. Soc. Lond., B, Biol. Sci. 306: 301 — 309.  PubMed DOI:10.1098/rstb.1984.0091

ПриміткиРедагувати

Див. такожРедагувати