Відкрити головне меню

Кератин-7 (англ. Keratin 7) – білок, який кодується геном KRT7, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 469 амінокислот, а молекулярна маса — 51 386[4].

Кератин-7
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KRT7, CK7, K2C7, K7, SCL, keratin 7
Зовнішні ІД OMIM: 148059 MGI: 96704 HomoloGene: 4058 GeneCards: KRT7
Шаблон експресії
PBB GE KRT7 209016 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005556
NM_033073
RefSeq (білок)
NP_005547
NP_149064
Локус (UCSC) Хр. 12: 52.23 – 52.25 Mb Хр. 15: 101.41 – 101.43 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVA
VRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN
KFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRG
QLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKD
VDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMD
NSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD
LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA
RAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEE
SRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPG
LLKAYSIRTASASRRSARD

Задіяний у такому біологічному процесі як взаємодія хазяїн-вірус. Локалізований у цитоплазмі.

ЛітератураРедагувати

  • Glass C., Kim K.H., Fuchs E. (1985). Sequence and expression of a human type II mesothelial keratin.. J. Cell Biol. 101: 2366 — 2373.  PubMed DOI:10.1083/jcb.101.6.2366
  • Glass C., Fuchs E. (1988). Isolation, sequence, and differential expression of a human K7 gene in simple epithelial cells.. J. Cell Biol. 107: 1337 — 1350.  PubMed DOI:10.1083/jcb.107.4.1337
  • Kaba A., Jiang P., Chany-Fournier F., Chany C. (1999). Sarcolectin (SCL): structure and expression of the recombinant molecule.. Biochimie 81: 709 — 715.  PubMed DOI:10.1016/S0300-9084(99)80128-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lin L., Holbro T., Alonso G., Gerosa D., Burger M.M. (2001). Molecular interaction between human tumor marker protein p150, the largest subunit of eIF3, and intermediate filament protein K7.. J. Cell. Biochem. 80: 483 — 490.  PubMed DOI:10.1002/1097-4644(20010315)80:4<483::AID-JCB1002>3.0.CO;2-B
  • Kanduc D. (2002). Translational regulation of human papillomavirus type 16 E7 mRNA by the peptide SEQIKA, shared by rabbit alpha(1)-globin and human cytokeratin 7.. J. Virol. 76: 7040 — 7048.  PubMed DOI:10.1128/JVI.76.14.7040-7048.2002

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6445 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, P08729 (англ.). Процитовано 21 серпня 2017. 

Див. такожРедагувати