Відкрити головне меню

DROSHA

білок-кодуючий ген Homo Sapiens
(Перенаправлено з Дроша)

DROSHA (англ. Drosha ribonuclease III) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 374 амінокислот, а молекулярна маса — 159 316[4].

DROSHA
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DROSHA, ETOHI2, HSA242976, RANSE3L, RN3, RNASE3L, RNASEN, drosha ribonuclease III
Зовнішні ІД MGI: 1261425 HomoloGene: 8293 GeneCards: DROSHA
Шаблон експресії
PBB GE RNASEN 218269 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001100412
NM_013235
NM_001130149
NM_026799
RefSeq (білок)
NP_001093882
NP_037367
NP_001123621
NP_081075
Локус (UCSC) Хр. 5: 31.4 – 31.53 Mb Хр. 15: 12.82 – 12.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MMQGNTCHRMSFHPGRGCPRGRGGHGARPSAPSFRPQNLRLLHPQQPPVQ
YQYEPPSAPSTTFSNSPAPNFLPPRPDFVPFPPPMPPSAQGPLPPCPIRP
PFPNHQMRHPFPVPPCFPPMPPPMPCPNNPPVPGAPPGQGTFPFMMPPPS
MPHPPPPPVMPQQVNYQYPPGYSHHNFPPPSFNSFQNNPSSFLPSANNSS
SPHFRHLPPYPLPKAPSERRSPERLKHYDDHRHRDHSHGRGERHRSLDRR
ERGRSPDRRRQDSRYRSDYDRGRTPSRHRSYERSRERERERHRHRDNRRS
PSLERSYKKEYKRSGRSYGLSVVPEPAGCTPELPGEIIKNTDSWAPPLEI
VNHRSPSREKKRARWEEEKDRWSDNQSSGKDKNYTSIKEKEPEETMPDKN
EEEEEELLKPVWIRCTHSENYYSSDPMDQVGDSTVVGTSRLRDLYDKFEE
ELGSRQEKAKAARPPWEPPKTKLDEDLESSSESECESDEDSTCSSSSDSE
VFDVIAEIKRKKAHPDRLHDELWYNDPGQMNDGPLCKCSAKARRTGIRHS
IYPGEEAIKPCRPMTNNAGRLFHYRITVSPPTNFLTDRPTVIEYDDHEYI
FEGFSMFAHAPLTNIPLCKVIRFNIDYTIHFIEEMMPENFCVKGLELFSL
FLFRDILELYDWNLKGPLFEDSPPCCPRFHFMPRFVRFLPDGGKEVLSMH
QILLYLLRCSKALVPEEEIANMLQWEELEWQKYAEECKGMIVTNPGTKPS
SVRIDQLDREQFNPDVITFPIIVHFGIRPAQLSYAGDPQYQKLWKSYVKL
RHLLANSPKVKQTDKQKLAQREEALQKIRQKNTMRREVTVELSSQGFWKT
GIRSDVCQHAMMLPVLTHHIRYHQCLMHLDKLIGYTFQDRCLLQLAMTHP
SHHLNFGMNPDHARNSLSNCGIRQPKYGDRKVHHMHMRKKGINTLINIMS
RLGQDDPTPSRINHNERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYR
TAIVQNQHLAMLAKKLELDRFMLYAHGPDLCRESDLRHAMANCFEALIGA
VYLEGSLEEAKQLFGRLLFNDPDLREVWLNYPLHPLQLQEPNTDRQLIET
SPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLG
DSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA
ITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLK
EFILNQDWNDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTV
AVYFKGERIGCGKGPSIQQAEMGAAMDALEKYNFPQMAHQKRFIERKYRQ
ELKEMRWEREHQEREPDETEDIKK

DROSHA за функціями належить до гідролаз, нуклеаз, ендонуклеаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як біогенез рибосом, РНК-залежне заглушення генів, альтернативний сплайсинг, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном магнію, РНК, іоном марганцю. Локалізований у ядрі.

ЛітератураРедагувати

  • Wu H., Xu H., Miraglia L.J., Crooke S.T. (2000). Human RNase III is a 160-kDa protein involved in preribosomal RNA processing.. J. Biol. Chem. 275: 36957 — 36965.  PubMed DOI:10.1074/jbc.M005494200
  • Gunther M., Laithier M., Brison O. (2000). A set of proteins interacting with transcription factor Sp1 identified in a two-hybrid screening.. Mol. Cell. Biochem. 210: 131 — 142.  PubMed DOI:10.1023/A:1007177623283
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Landthaler M., Yalcin A., Tuschl T. (2004). The human DiGeorge syndrome critical region gene 8 and its D. melanogaster homolog are required for miRNA biogenesis.. Curr. Biol. 14: 2162 — 2167.  PubMed DOI:10.1016/j.cub.2004.11.001
  • Zeng Y., Yi R., Cullen B.R. (2005). Recognition and cleavage of primary microRNA precursors by the nuclear processing enzyme Drosha.. EMBO J. 24: 138 — 148.  PubMed DOI:10.1038/sj.emboj.7600491
  • Faller M., Matsunaga M., Yin S., Loo J.A., Guo F. (2007). Heme is involved in microRNA processing.. Nat. Struct. Mol. Biol. 14: 23 — 29.  PubMed DOI:10.1038/nsmb1182

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17904 (англ.). Процитовано 5 вересня 2017. 
  4. UniProt, Q9NRR4 (англ.). Процитовано 5 вересня 2017. 

Див. такожРедагувати