Десмін (англ. Desmin) – білок, який кодується геном DES, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 470 амінокислот, а молекулярна маса — 53 536[5].

DES
Ідентифікатори
Символи DES, CSM1, CSM2, LGMD2R, desmin, LGMD1D, CMD1F, CDCD3, LGMD1E
Зовнішні ІД OMIM: 125660 MGI: 94885 HomoloGene: 56469 GeneCards: DES
Пов'язані генетичні захворювання
dilated cardiomyopathy 1I, Neurogenic scapuloperoneal syndrome, Kaeser type, myofibrillar myopathy[1]
Шаблон експресії
PBB GE DES 214027 x at fs.png

PBB GE DES 202222 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001927
NM_010043
RefSeq (білок)
NP_034173
Локус (UCSC) Хр. 2: 219.42 – 219.43 Mb Хр. 1: 75.36 – 75.37 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVT
SRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQE
FLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTR
VAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQL
KEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIREL
QAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKV
SDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMR
ELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDV
EIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKT
IETRDGEVVSEATQQQHEVL

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Входить до складу проміжних філаментів.

Локалізований у клітинній мембрані, цитоплазмі, мембрані.

ЛітератураРедагувати

  • Li Z., Lilienbaum A., Butler-Browne G., Paulin D. (1989). Human desmin-coding gene: complete nucleotide sequence, characterization and regulation of expression during myogenesis and development.. Gene 78: 243 — 254.  PubMed DOI:10.1016/0378-1119(89)90227-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wang W., Sumiyoshi H., Yoshioka H., Fujiwara S. (2006). Interactions between epiplakin and intermediate filaments.. J. Dermatol. 33: 518 — 527.  PubMed DOI:10.1111/j.1346-8138.2006.00127.x
  • Goldfarb L.G., Vicart P., Goebel H.H., Dalakas M.C. (2004). Desmin myopathy.. Brain 127: 723 — 734.  PubMed DOI:10.1093/brain/awh033
  • Paulin D., Huet A., Khanamyrian L., Xue Z. (2004). Desminopathies in muscle disease.. J. Pathol. 204: 418 — 427.  PubMed DOI:10.1002/path.1639
  • Selcen D., Ohno K., Engel A.G. (2004). Myofibrillar myopathy: clinical, morphological and genetic studies in 63 patients.. Brain 127: 439 — 451.  PubMed DOI:10.1093/brain/awh052

ПриміткиРедагувати

Див. такожРедагувати