Відкрити головне меню

Гістон H2bb (англ. Histone cluster 1 H2B family member b) – білок, який кодується геном HIST1H2BB, розташованим у людей на короткому плечі 6-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 126 амінокислот, а молекулярна маса — 13 950[4].

Гістон H2bb
Protein HIST1H2BB PDB 1aoi.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи H2BC3, H2B.1, H2B/f, H2BFF, histone cluster 1, H2bb, histone cluster 1 H2B family member b, HIST1H2BB, H2B clustered histone 3
Зовнішні ІД OMIM: 602803 MGI: 2448377 HomoloGene: 137348 GeneCards: H2BC3
Шаблон експресії
PBB GE HIST1H2BB 208547 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021062
NM_175664
RefSeq (білок)
NP_066406
NP_783595
Локус (UCSC) Хр. 6: 26.04 – 26.04 Mb Хр. 13: 23.75 – 23.75 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Представник родини білків гістонів H2B[en].

Послідовність амінокислот
1020304050
MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVH
PDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
LLLPGELAKHAVSEGTKAVTKYTSSK

Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

ЛітератураРедагувати

  • Albig W., Kardalinou E., Drabent B., Zimmer A., Doenecke D. (1991). Isolation and characterization of two human H1 histone genes within clusters of core histone genes.. Genomics 10: 940 — 948.  PubMed DOI:10.1016/0888-7543(91)90183-F
  • Marzluff W.F., Gongidi P., Woods K.R., Jin J., Maltais L.J. (2002). The human and mouse replication-dependent histone genes.. Genomics 80: 487 — 498.  PubMed DOI:10.1006/geno.2002.6850
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Galasinski S.C., Louie D.F., Gloor K.K., Resing K.A., Ahn N.G. (2002). Global regulation of post-translational modifications on core histones.. J. Biol. Chem. 277: 2579 — 2588.  PubMed DOI:10.1074/jbc.M107894200
  • Golebiowski F., Kasprzak K.S. (2005). Inhibition of core histones acetylation by carcinogenic nickel(II).. Mol. Cell. Biochem. 279: 133 — 139.  PubMed DOI:10.1007/s11010-005-8285-1
  • Wu L., Zee B.M., Wang Y., Garcia B.A., Dou Y. (2011). The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.. Mol. Cell 43: 132 — 144.  PubMed DOI:10.1016/j.molcel.2011.05.015

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4751 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P33778 (англ.). Процитовано 30 січня 2017. 

Див. такожРедагувати