Відкрити головне меню

Гемопексин (англ. Hemopexin) – білок, який кодується геном HPX, розташованим у людей на короткому плечі 11-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 462 амінокислот, а молекулярна маса — 51 676[4].

Гемопексин
Ідентифікатори
Символи HPX, HX, hemopexin
Зовнішні ІД OMIM: 142290 MGI: 105112 HomoloGene: 511 GeneCards: HPX
Шаблон експресії
PBB GE HPX 39763 at fs.png

PBB GE HPX 210013 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000613
NM_017371
RefSeq (білок)
NP_000604
NP_059067
Локус (UCSC) Хр. 11: 6.43 – 6.44 Mb Хр. 7: 105.59 – 105.6 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERC
SDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAA
FRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECH
RGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYC
FQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHH
GPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ
WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVG
TPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPH
EKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQ
PQNVTSLLGCTH

Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, транспорт кисню. Білок має сайт для зв'язування з іоном заліза, гемом. Секретований назовні.

ЛітератураРедагувати

  • Altruda F., Poli V., Restagno G., Silengo L. (1988). Structure of the human hemopexin gene and evidence for intron-mediated evolution.. J. Mol. Evol. 27: 102 — 108.  PubMed DOI:10.1007/BF02138368
  • Law M.L., Cai G.Y., Hartz J.A., Jones C., Kao F.T. (1988). The hemopexin gene maps to the same location as the beta-globin gene cluster on human chromosome 11.. Genomics 3: 48 — 52.  PubMed DOI:10.1016/0888-7543(88)90158-9
  • Takahashi N., Takahashi Y., Putnam F.W. (1985). Complete amino acid sequence of human hemopexin, the heme-binding protein of serum.. Proc. Natl. Acad. Sci. U.S.A. 82: 73 — 77.  PubMed DOI:10.1073/pnas.82.1.73
  • Frantikova V., Borvak J., Kluh I., Moravek L. (1984). Amino acid sequence of the N-terminal region of human hemopexin.. FEBS Lett. 178: 213 — 216.  PubMed DOI:10.1016/0014-5793(84)80603-1
  • Takahashi N., Takahashi Y., Putnam F.W. (1984). Structure of human hemopexin: O-glycosyl and N-glycosyl sites and unusual clustering of tryptophan residues.. Proc. Natl. Acad. Sci. U.S.A. 81: 2021 — 2025.  PubMed DOI:10.1073/pnas.81.7.2021
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.. Proteomics 4: 454 — 465.  PubMed DOI:10.1002/pmic.200300556

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5171 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P02790 (англ.). Процитовано 30 січня 2017. 

Див. такожРедагувати