Відкрити головне меню

Вінкулін (англ. Vinculin) – білок, який кодується геном VCL, розташованим у людей на короткому плечі 10-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 1 134 амінокислот, а молекулярна маса — 123 799[5].

Вінкулін
Protein VCL PDB 1qkr.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи VCL, CMD1W, CMH15, HEL114, MV, Mvinculin
Зовнішні ІД OMIM: 193065 MGI: 98927 HomoloGene: 7594 GeneCards: VCL
Пов'язані генетичні захворювання
dilated cardiomyopathy 1W, hypertrophic cardiomyopathy 15[1]
Шаблон експресії
PBB GE VCL 200930 s at fs.png

PBB GE VCL 200931 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003373
NM_014000
NM_009502
RefSeq (білок)
NP_003364
NP_054706
NP_033528
Локус (UCSC) Хр. 10: 74 – 74.12 Mb Хр. 14: 20.93 – 21.03 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAA
VSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPY
SVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEV
VETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKE
LLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQL
TSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAM
QKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNG
GPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEISALTSKLADLRR
QGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQA
QRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQ
LTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAV
GTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKN
QWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLV
AGATSIARRANRILLVAKREVENSEDPKFREAVKAASDELSKTISPMVMD
AKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLE
QLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYE
PELLLMPSNQPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAE
MSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLL
QVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQ
SVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ

Задіяний у такому біологічному процесі як клітинна адгезія. Білок має сайт для зв'язування з молекулою актину. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sun N., Critchley D.R., Paulin D., Li Z., Robson R.M. (2008). Human alpha-synemin interacts directly with vinculin and metavinculin.. Biochem. J. 409: 657 — 667.  PubMed DOI:10.1042/BJ20071188
  • Le Clainche C., Dwivedi S.P., Didry D., Carlier M.F. (2010). Vinculin is a dually regulated actin filament barbed end-capping and side-binding protein.. J. Biol. Chem. 285: 23420 — 23432.  PubMed DOI:10.1074/jbc.M110.102830
  • Janssen M.E., Liu H., Volkmann N., Hanein D. (2012). The C-terminal tail domain of metavinculin, vinculin's splice variant, severs actin filaments.. J. Cell Biol. 197: 585 — 593.  PubMed DOI:10.1083/jcb.201111046
  • Izard T., Vonrhein C. (2004). Structural basis for amplifying vinculin activation by talin.. J. Biol. Chem. 279: 27667 — 27678.  PubMed DOI:10.1074/jbc.M403076200
  • Vasile V.C., Ommen S.R., Edwards W.D., Ackerman M.J. (2006). A missense mutation in a ubiquitously expressed protein, vinculin, confers susceptibility to hypertrophic cardiomyopathy.. Biochem. Biophys. Res. Commun. 345: 998 — 1003.  PubMed DOI:10.1016/j.bbrc.2006.04.151

ПриміткиРедагувати

Див. такожРедагувати