ASL (англ. Argininosuccinate lyase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 464 амінокислот, а молекулярна маса — 51 658[2].

ASL
Ідентифікатори
Символи argininosuccinaseargininosuccinate lyasearginosuccinaseASL
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLE
KAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELI
GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE
RDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLG
SGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCM
THLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA
GRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI
STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAET
KGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDW
QIRQVRALLQAQQA

Кодований геном білок за функцією належить до ліаз. Задіяний у таких біологічних процесах, як біосинтез амінокислот, ацетилювання, альтернативний сплайсинг.

ЛітератураРедагувати

  • Matuo S., Tatsuno M., Kobayashi K., Saheki T., Miyata T. (1988). Isolation of cDNA clones of human argininosuccinate lyase and corrected amino acid sequence.. FEBS Lett. 234: 395 — 399.  PubMed DOI:10.1016/0014-5793(88)80124-8
  • O'Brien W.E., McInnes R., Kalumuck K., Adcock M. (1986). Cloning and sequence analysis of cDNA for human argininosuccinate lyase.. Proc. Natl. Acad. Sci. U.S.A. 83: 7211 — 7215.  PubMed DOI:10.1073/pnas.83.19.7211
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Turner M.A., Simpson A., McInnes R.R., Howell P.L. (1997). Human argininosuccinate lyase: a structural basis for intragenic complementation.. Proc. Natl. Acad. Sci. U.S.A. 94: 9063 — 9068.  PubMed DOI:10.1073/pnas.94.17.9063
  • Sampaleanu L.M., Vallee F., Thompson G.D., Howell P.L. (2001). Three-dimensional structure of the argininosuccinate lyase frequently complementing allele Q286R.. Biochemistry 40: 15570 — 15580.  PubMed DOI:10.1021/bi011525m
  • Walker D.C., McCloskey D.A., Simard L.R., McInnes R.R. (1990). Molecular analysis of human argininosuccinate lyase: mutant characterization and alternative splicing of the coding region.. Proc. Natl. Acad. Sci. U.S.A. 87: 9625 — 9629.  PubMed DOI:10.1073/pnas.87.24.9625

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:746 (англ.). Процитовано 7 вересня 2017. 
  2. UniProt, P04424 (англ.). Процитовано 7 вересня 2017. 

Див. такожРедагувати