Альфа-2-HS-глікопротеїн

білок-кодуючий ген Homo Sapiens

Альфа-2-HS-глікопротеїн (англ. Alpha 2-HS glycoprotein) – білок, який кодується геном AHSG, розташованим у людей на короткому плечі 3-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 367 амінокислот, а молекулярна маса — 39 325[4].

Альфа-2-HS-глікопротеїн
Ідентифікатори
Символи AHSG, A2HS, AHS, FETUA, HSGA, alpha-2-HS-glycoprotein, alpha 2-HS glycoprotein
Зовнішні ІД OMIM: 138680 MGI: 107189 HomoloGene: 1225 GeneCards: AHSG
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001622
NM_001276449
NM_001276450
NM_013465
RefSeq (білок)
NP_001613
NP_001341500
NP_001341501
NP_001341502
NP_001263378
NP_001263379
NP_038493
Локус (UCSC) н/д Хр. 16: 22.71 – 22.72 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQ
NLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARC
SVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCP
LLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVE
FTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVF
QTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA
AGPVVPPCPGRIRHFKV

Задіяний у такому біологічному процесі як мінеральний обмін. Секретований назовні.

Література ред.

  • Lee C.-C., Bowman B.H., Yang F. (1987). Human alpha 2-HS-glycoprotein: the A and B chains with a connecting sequence are encoded by a single mRNA transcript. Proc. Natl. Acad. Sci. U.S.A. 84: 4403—4407. PMID 3474608 DOI:10.1073/pnas.84.13.4403
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Araki T., Yoshioka Y., Schmid K. (1989). The position of the disulfide bonds in human plasma alpha 2 HS-glycoprotein and the repeating double disulfide bonds in the domain structure. Biochim. Biophys. Acta. 994: 195—199. PMID 2645941 DOI:10.1016/0167-4838(89)90293-8
  • Haglund A.C., Ek B., Ek P. (2001). Phosphorylation of human plasma alpha2-Heremans-Schmid glycoprotein (human fetuin) in vivo. Biochem. J. 357: 437—445. PMID 11439093 DOI:10.1042/0264-6021:3570437
  • Zhang H., Li X.-J., Martin D.B., Aebersold R. (2003). Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat. Biotechnol. 21: 660—666. PMID 12754519 DOI:10.1038/nbt827
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 4: 454—465. PMID 14760718 DOI:10.1002/pmic.200300556

Примітки ред.

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:349 (англ.) . Процитовано 30 січня 2017.
  4. UniProt, P02765 (англ.) . Архів оригіналу за 15 березня 2017. Процитовано 30 січня 2017.

Див. також ред.