Відкрити головне меню

Ізоцитратдегідрогеназа-2 (англ. Isocitrate dehydrogenase (NADP(+)) 2, mitochondrial) – білок, який кодується геном IDH2, розташованим у людей на короткому плечі 15-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 452 амінокислот, а молекулярна маса — 50 909[4].

Ізоцитратдегідрогеназа-2
Protein IDH2 PDB 1lwd.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IDH2, D2HGA2, ICD-M, IDH, IDHM, IDP, IDPM, mNADP-IDH, isocitrate dehydrogenase (NADP(+)) 2, mitochondrial, isocitrate dehydrogenase (NADP(+)) 2
Зовнішні ІД OMIM: 147650 MGI: 96414 HomoloGene: 37590 GeneCards: IDH2
Шаблон експресії
PBB GE IDH2 210045 at fs.png

PBB GE IDH2 210046 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002168
NM_001289910
NM_001290114
NM_173011
RefSeq (білок)
NP_001276839
NP_001277043
NP_002159
NP_766599
Локус (UCSC) Хр. 15: 90.08 – 90.1 Mb Хр. 7: 80.09 – 80.12 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPV
VEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDS
ALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFRE
PIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKD
GSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMST
KNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEK
VCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALG
RQ

Цей білок за функцією належить до оксидоредуктаз. Задіяний у такому біологічному процесі як цикл трикарбонових кислот. Білок має сайт для зв'язування з іонами металів, іоном магнію, НАДФ, іоном марганцю. Локалізований у мітохондрії.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yu W., Dittenhafer-Reed K.E., Denu J.M. (2012). SIRT3 protein deacetylates isocitrate dehydrogenase 2 (IDH2) and regulates mitochondrial redox status.. J. Biol. Chem. 287: 14078 — 14086.  PubMed DOI:10.1074/jbc.M112.355206

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5383 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P48735 (англ.). Процитовано 30 січня 2017. 

Див. такожРедагувати