Відкрити головне меню

Альфа-синуклеїн

білок-кодуючий ген Homo Sapiens
(Перенаправлено з Α-синуклеїн)

Альфа-синуклеїн (англ. Synuclein alpha) – неструктурований білок, що зустрічається у великих кількостях в мозку людей та інших хордових[4][5][6][7]. Кодується геном SNCA, розташованим у людини на довгому плечі 4-ї хромосоми.[8] Довжина поліпептидного ланцюга білка становить 140 амінокислотних залишків, а молекулярна маса — 14 460[9].

Α-синуклеїн
Alfa-sinucleina.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SNCA, NACP, PARK1, PARK4, PD1, synuclein alpha
Зовнішні ІД OMIM: 163890 MGI: 1277151 HomoloGene: 293 GeneCards: SNCA
Пов'язані генетичні захворювання
хвороба Паркінсона[1]
Шаблон експресії
PBB GE SNCA 204466 s at fs.png

PBB GE SNCA 204467 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000345
NM_001146054
NM_001146055
NM_007308
NM_001042451
NM_009221
RefSeq (білок)
NP_000336
NP_001139526
NP_001139527
NP_009292
NP_001035916
NP_033247
Локус (UCSC) Хр. 4: 89.72 – 89.84 Mb Хр. 6: 60.73 – 60.83 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH
GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL
GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Білок має сайт для зв'язування з іоном міді. Він локалізується переважно в точках контакту нейронів, синапсах. Також секретований назовні.

Зміст

СтруктураРедагувати

Прийнято виділяти три основні домени в послідовності α-синуклеїну:

  • амфіфільний N-кінцевий фрагмент (залишки 1-60), що має сильну спорідненість до мембран
  • аполярний NAC регіон (від англійського non-amyloid-β component), що є основною причиною утворення амілоїдних фібрил[5] (залишки 61-95)
  • негативно заряджений гідрофільний C-кінець, що забезпечує розчинність протеїну (залишки 96-140)

Цей поділ є умовним і вказує лишень що дані фрагменти відіграють в наведених взаємодіях більшу роль, ніж інші.

ФункціяРедагувати

Фізіологічна функція α-синуклеїну ще не з'ясована, але з огляду на локалізацію вважається, що він бере участь в передачі нервових сигналів[4]

Результати досліджень вказують на його взаємодію з ліпідами мембран[10] та низкою білків,[4] а також ймовірну участь у циркуляції синаптичних везикул.[11]

α-Cинуклеїн є основним компонентом амілоїдних фібрил, що утворюють паталогічні агрегати в мозку пацієнтів вражених хворобою Паркінсона.

МутаціїРедагувати

Декілька мутацій в послідовності α-синуклеїну призводять до різкого зростання ймовірності розвитку хвороби Паркінсона. A30P, A53T, E56K, нещодавно[коли?] також було повідомлено про патогеність мутацій H50Q і G51D.

ЛітератураРедагувати

  • Ueda K., Saitoh T., Mori H. (1994). Tissue-dependent alternative splicing of mRNA for NACP, the precursor of non-A beta component of Alzheimer's disease amyloid.. Biochem. Biophys. Res. Commun. 205: 1366 — 1372.  PubMed DOI:10.1006/bbrc.1994.2816
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Pronin A.N., Morris A.J., Surguchov A., Benovic J.L. (2000). Synucleins are a novel class of substrates for G protein-coupled receptor kinases.. J. Biol. Chem. 275: 26515 — 26522.  PubMed DOI:10.1074/jbc.M003542200
  • Nakamura T., Yamashita H., Takahashi T., Nakamura S. (2001). Activated Fyn phosphorylates alpha-synuclein at tyrosine residue 125.. Biochem. Biophys. Res. Commun. 280: 1085 — 1092.  PubMed DOI:10.1006/bbrc.2000.4253
  • Alves da Costa C. (2003). Recent advances on alpha-synuclein cell biology: functions and dysfunctions.. Curr. Mol. Med. 3: 17 — 24.  PubMed DOI:10.2174/1566524033361690
  • Waxman E.A., Mazzulli J.R., Giasson B.I. (2009). Characterization of hydrophobic residue requirements for alpha-synuclein fibrillization.. Biochemistry 48: 9427 — 9436.  PubMed DOI:10.1021/bi900539p

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з Α-синуклеїн переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. а б в Genetics Home Reference: SNCA. U.S. National Library of Medicine. 12 Nov 2013. Процитовано 14 Nov 2013. 
  5. а б Uéda K, Fukushima H, Masliah E, Xia Y, Iwai A, Yoshimoto M, Otero DA, Kondo J, Ihara Y, Saitoh T (Dec 1993). Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease. Proceedings of the National Academy of Sciences of the United States of America 90 (23). с. 11282–6. PMC 47966. PMID 8248242. doi:10.1073/pnas.90.23.11282. 
  6. Xia Y, Saitoh T, Uéda K, Tanaka S, Chen X, Hashimoto M, Hsu L, Conrad C, Sundsmo M, Yoshimoto M, Thal L, Katzman R, Masliah E (Oct 2001). Characterization of the human alpha-synuclein gene: Genomic structure, transcription start site, promoter region and polymorphisms. Journal of Alzheimer's Disease 3 (5). с. 485–494. PMID 12214035. 
  7. Xia Y, Saitoh T, Uéda K, Tanaka S, Chen X, Hashimoto M, Hsu L, Conrad C, Sundsmo M, Yoshimoto M, Thal L, Katzman R, Masliah E (2002). Characterization of the human alpha-synuclein gene: Genomic structure, transcription start site, promoter region and polymorphisms: Erratum p489 Fig 3. J. Alzheimers Dis. 4 (4). с. 337. 
  8. HUGO Gene Nomenclature Commitee, HGNC:11138 (англ.). Процитовано 26 квітня 2018. 
  9. UniProt, P37840 (англ.). Процитовано 26 квітня 2018. 
  10. Chandra S, Chen X, Rizo J, Jahn R, Südhof TC (Apr 2003). A broken alpha-helix in folded alpha-Synuclein. The Journal of Biological Chemistry 278 (17). с. 15313–8. PMID 12586824. doi:10.1074/jbc.M213128200. 
  11. Diao J, Burré J, Vivona S, Cipriano DJ, Sharma M, Kyoung M, Südhof TC, Brunger AT (2013). Native α-synuclein induces clustering of synaptic-vesicle mimics via binding to phospholipids and synaptobrevin-2/VAMP2. eLife 2. с. e00592. PMC 3639508. PMID 23638301. doi:10.7554/eLife.00592. 

Див. такожРедагувати