Відкрити головне меню

CXCL6 (англ. C-X-C motif chemokine ligand 6) – білок, який кодується однойменним геном, розташованим у людей на 4-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 114 амінокислот, а молекулярна маса — 11 897[4].

CXCL6
Ідентифікатори
Символи CXCL6, CKA-3, GCP-2, GCP2, SCYB6, C-X-C motif chemokine ligand 6
Зовнішні ІД MGI: 1096868 HomoloGene: 88671 GeneCards: CXCL6
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002993
NM_009141
RefSeq (білок)
NP_002984
NP_033167
Локус (UCSC) Хр. 4: 73.84 – 73.85 Mb Хр. 5: 90.76 – 90.76 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCT
CLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLK
KVIQKILDSGNKKN

Кодований геном білок за функціями належить до цитокінів, антибіотиків, антимікробних білків. Задіяний у такому біологічному процесі, як хемотаксис. Білок має сайт для зв'язування з з молекулою гепарину. Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rovai L.E., Herschman H.R., Smith J.B. (1997). Cloning and characterization of the human granulocyte chemotactic protein-2 gene.. J. Immunol. 158: 5257 — 5266.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:10643 (англ.). Процитовано 18 вересня 2017. 
  4. UniProt, P80162 (англ.). Процитовано 18 вересня 2017. 

Див. такожРедагувати