Відкрити головне меню

CXCL10 (англ. C-X-C motif chemokine ligand 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 98 амінокислот, а молекулярна маса — 10 881[4].

CXCL10
PDB 1o7z EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CXCL10, C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1, C-X-C motif chemokine ligand 10, C-X-C motif chemokine 10
Зовнішні ІД OMIM: 147310 MGI: 1352450 HomoloGene: 1203 GeneCards: CXCL10
Шаблон експресії
PBB GE CXCL10 204533 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001565
NM_021274
RefSeq (білок)
NP_001556
NP_067249
Локус (UCSC) Хр. 4: 76.02 – 76.02 Mb Хр. 5: 92.35 – 92.35 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEI
IPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах як запальна відповідь, хемотаксис. Секретований назовні.

ЛітератураРедагувати

  • Luster A.D., Unkeless J.C., Ravetch J.V. (1985). Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins.. Nature 315: 672 — 676.  PubMed DOI:10.1038/315672a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Booth V., Keizer D.W., Kamphuis M.B., Clark-Lewis I., Sykes B.D. (2002). The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions.. Biochemistry 41: 10418 — 10425.  PubMed DOI:10.1021/bi026020q

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:10637 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P02778 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати