Відкрити головне меню

LIF (англ. LIF, interleukin 6 family cytokine) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 202 амінокислот, а молекулярна маса — 22 008[4].

LIF
LIF Crystal Structure.rsh.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LIF, CDF, DIA, HILDA, MLPLI, leukemia inhibitory factor, interleukin 6 family cytokine, LIF interleukin 6 family cytokine
Зовнішні ІД OMIM: 159540 MGI: 96787 HomoloGene: 1734 GeneCards: LIF
Шаблон експресії
PBB GE LIF 205266 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001257135
NM_002309
NM_001039537
NM_008501
RefSeq (білок)
NP_001244064
NP_002300
NP_001034626
NP_032527
Локус (UCSC) Хр. 22: 30.24 – 30.25 Mb Хр. 11: 4.26 – 4.27 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRS
QLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKA
KLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSN
VLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQ
AF

Кодований геном білок за функціями належить до цитокінів, факторів росту. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mori M., Yamaguchi K., Abe K. (1989). Purification of a lipoprotein lipase-inhibiting protein produced by a melanoma cell line associated with cancer cachexia.. Biochem. Biophys. Res. Commun. 160: 1085 — 1092.  PubMed DOI:10.1016/S0006-291X(89)80114-7
  • Boulanger M.J., Bankovich A.J., Kortemme T., Baker D., Garcia K.C. (2003). Convergent mechanisms for recognition of divergent cytokines by the shared signaling receptor gp130.. Mol. Cell 12: 577 — 589.  PubMed DOI:10.1016/S1097-2765(03)00365-4

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6596 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P15018 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати