SPARCL1

білок-кодуючий ген Homo Sapiens

SPARCL1 (англ. SPARC like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 664 амінокислот, а молекулярна маса — 75 208[4].

SPARCL1
Ідентифікатори
Символи SPARCL1, MAST 9, MAST9, PIG33, SC1, SPARC like 1
Зовнішні ІД OMIM: 606041 MGI: 108110 HomoloGene: 3438 GeneCards: SPARCL1
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004684
NM_001128310
NM_001291976
NM_001291977
NM_010097
NM_001359014
NM_001359016
RefSeq (білок)
NP_001121782
NP_001278905
NP_001278906
NP_004675
NP_034227
NP_001345943
NP_001345945
Локус (UCSC) Хр. 4: 87.47 – 87.53 Mb Хр. 5: 104.23 – 104.26 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKTGLFFLCLLGTAAAIPTNARLLSDHSKPTAETVAPDNTAIPSLRAEAE
ENEKETAVSTEDDSHHKAEKSSVLKSKEESHEQSAEQGKSSSQELGLKDQ
EDSDGHLSVNLEYAPTEGTLDIKEDMSEPQEKKLSENTDFLAPGVSSFTD
SNQQESITKREENQEQPRNYSHHQLNRSSKHSQGLRDQGNQEQDPNISNG
EEEEEKEPGEVGTHNDNQERKTELPREHANSKQEEDNTQSDDILEESDQP
TQVSKMQEDEFDQGNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT
GLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGT
DGPRHSASDDYFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTTE
PGEHQEAKKAENSSNEEETSSEGNMRVHAVDSCMSFQCKRGHICKADQQG
KPHCVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKCRLEGTKKGHQ
LQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYEANSEHAGYLN
EKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELD
QHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHC
FGIKEEDIDENLLF

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література ред.

  • Girard J.-P., Springer T.A. (1995). Cloning from purified high endothelial venule cells of hevin, a close relative of the antiadhesive extracellular matrix protein SPARC. Immunity. 2: 113—123. PMID 7600298 DOI:10.1016/1074-7613(95)90083-7
  • Halim A., Ruetschi U., Larson G., Nilsson J. (2013). LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins. J. Proteome Res. 12: 573—584. PMID 23234360 DOI:10.1021/pr300963h

Примітки ред.

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:11220 (англ.) . Архів оригіналу за 14 жовтня 2017. Процитовано 30 серпня 2017.
  4. UniProt, Q14515 (англ.) . Архів оригіналу за 22 листопада 2016. Процитовано 30 серпня 2017.

Див. також ред.