RAD51 (англ. RAD51 recombinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 339 амінокислот, а молекулярна маса — 36 966[2].

RAD51
Ідентифікатори
Символи RAD51RecAE. colihomolog ofBRCA1/BRCA2-containing complexsubunit 5recombination protein ADNA repair protein RAD51 homolog 1RecA-like proteinRAD51 homolog A
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE RAD51 205024 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVE
AVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEII
QITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDR
GGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQ
TQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLR
MLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як пошкодження ДНК, репарація ДНК, рекомбінація ДНК, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі, мітохондрії.

ЛітератураРедагувати

  • Yoshimura Y., Morita T., Yamamoto A., Matsushiro A. (1993). Cloning and sequence of the human RecA-like gene cDNA.. Nucleic Acids Res. 21: 1665 — 1665.  PubMed DOI:10.1093/nar/21.7.1665
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Golub E.I., Kovalenko O.V., Gupta R.C., Ward D.C., Radding C.M. (1997). Interaction of human recombination proteins Rad51 and Rad54.. Nucleic Acids Res. 25: 4106 — 4110.  PubMed DOI:10.1093/nar/25.20.4106
  • Kovalenko O.V., Golub E.I., Bray-Ward P., Ward D.C., Radding C.M. (1997). A novel nucleic acid-binding protein that interacts with human rad51 recombinase.. Nucleic Acids Res. 25: 4946 — 4953.  PubMed DOI:10.1093/nar/25.24.4946
  • Tanaka K., Hiramoto T., Fukuda T., Miyagawa K. (2000). A novel human Rad54 homologue, Rad54B, associates with Rad51.. J. Biol. Chem. 275: 26316 — 26321.  PubMed DOI:10.1074/jbc.M910306199
  • Sigurdsson S., Van Komen S., Petukhova G., Sung P. (2002). Homologous DNA pairing by human recombination factors Rad51 and Rad54.. J. Biol. Chem. 277: 42790 — 42794.  PubMed DOI:10.1074/jbc.M208004200

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:9817 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, Q06609 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати