Відкрити головне меню

PTS (англ. 6-pyruvoyltetrahydropterin synthase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 145 амінокислот, а молекулярна маса — 16 386[4].

PTS
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PTS, Pts, PTPS, 6-pyruvoyltetrahydropterin synthase, 6-pyruvoyl-tetrahydropterin synthase
Зовнішні ІД OMIM: 612719 MGI: 1338783 HomoloGene: 268 GeneCards: PTS
Шаблон експресії
PBB GE PTS 209694 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000317
NM_011220
RefSeq (білок)
NP_000308
NP_035350
NP_001351417
NP_001351418
NP_001351419
Локус (UCSC) Хр. 11: 112.23 – 112.27 Mb Хр. 9: 50.52 – 50.53 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHG
HNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYF
ADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Кодований геном білок за функціями належить до ліаз, фосфопротеїнів. Білок має сайт для зв'язування з іонами металів, іоном цинку.

ЛітератураРедагувати

  • Thoeny B., Leimbacher W., Buergisser D., Heizmann C.W. (1992). Human 6-pyruvoyltetrahydropterin synthase: cDNA cloning and heterologous expression of the recombinant enzyme.. Biochem. Biophys. Res. Commun. 189: 1437 — 1443.  PubMed DOI:10.1016/0006-291X(92)90235-D
  • Ashida A., Hatakeyama K., Kagamiyama H. (1993). cDNA cloning, expression in Escherichia coli and purification of human 6-pyruvoyl-tetrahydropterin synthase.. Biochem. Biophys. Res. Commun. 195: 1386 — 1393.  PubMed DOI:10.1006/bbrc.1993.2197
  • Ashida A., Owada M., Hatakeyama K. (1994). A missense mutation (A to G) of 6-pyruvoyltetrahydropterin synthase in tetrahydrobiopterin-deficient form of hyperphenylalaninemia.. Genomics 24: 408 — 410.  PubMed DOI:10.1006/geno.1994.1642
  • Kluge C., Brecevic L., Heizmann C.W., Blau N., Thoeny B. (1996). Chromosomal localization, genomic structure and characterization of the human gene and a retropseudogene for 6-pyruvoyltetrahydropterin synthase.. Eur. J. Biochem. 240: 477 — 484.  PubMed DOI:10.1111/j.1432-1033.1996.0477h.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Scherer-Oppliger T., Leimbacher W., Blau N., Thoeny B. (1999). Serine 19 of human 6-pyruvoyltetrahydropterin synthase is phosphorylated by cGMP protein kinase II.. J. Biol. Chem. 274: 31341 — 31348.  PubMed DOI:10.1074/jbc.274.44.31341

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9689 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q03393 (англ.). Процитовано 8 вересня 2017. 

Див. такожРедагувати