Відкрити головне меню

PEX2 (англ. Peroxisomal biogenesis factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 305 амінокислот, а молекулярна маса — 34 843[4].

PEX2
Ідентифікатори
Символи PEX2, PAF1, PBD5A, PBD5B, PMP3, PMP35, PXMP3, RNF72, ZWS3, peroxisomal biogenesis factor 2
Зовнішні ІД OMIM: 170993 MGI: 107486 HomoloGene: 269 GeneCards: PEX2
Шаблон експресії
PBB GE PXMP3 210296 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001172087
NM_000318
NM_001079867
NM_001172086
RefSeq (білок)
NP_000309
NP_001073336
NP_001165557
NP_001165558
Локус (UCSC) Хр. 8: 76.98 – 77 Mb Хр. 3: 5.56 – 5.58 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLA
RFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSK
NQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQCVNFVIGLLKLGG
LINFLIFLQRGKFATLTERLLGIHSVFCKPQNICEVGFEYMNRELLWHGF
AEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGEW
PTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMS
EVNAL

Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у мембрані, пероксисомах.

ЛітератураРедагувати

  • Biermanns M., Gaertner J. (2000). Genomic organization and characterization of human PEX2 encoding a 35-kDa peroxisomal membrane protein.. Biochem. Biophys. Res. Commun. 273: 985 — 990.  PubMed DOI:10.1006/bbrc.2000.3039
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Patarca R., Fletcher M.A. (1992). Ring finger in the peroxisome assembly factor-1.. FEBS Lett. 312: 1 — 2.  PubMed DOI:10.1016/0014-5793(92)81397-5

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9717 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P28328 (англ.). Процитовано 7 вересня 2017. 

Див. такожРедагувати