PAPPA (англ. Pappalysin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 627 амінокислот, а молекулярна маса — 180 973[4].

PAPPA
Ідентифікатори
Символи PAPPA, ASBABP2, DIPLA1, IGFBP-4ase, PAPA, PAPP-A, PAPPA1, pappalysin 1
Зовнішні ІД OMIM: 176385 MGI: 97479 HomoloGene: 31097 GeneCards: PAPPA
Шаблон експресії
PBB GE PAPPA 201982 s at fs.png

PBB GE PAPPA 201981 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002581
NM_021362
RefSeq (білок)
NP_002572
NP_067337
Локус (UCSC) Хр. 9: 116.15 – 116.4 Mb Хр. 4: 65.04 – 65.28 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRLWSWVLHLGLLSAALGCGLAERPRRARRDPRAGRPPRPAAGPATCATR
AARGRRASPPPPPPPGGAWEAVRVPRRRQQREARGATEEPSPPSRALYFS
GRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRD
RGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPGQWVYLA
ATYDGQFMKLYVNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNHNYR
GYIEHFSLWKVARTQREILSDMETHGAHTALPQLLLQENWDNVKHAWSPM
KDGSSPKVEFSNAHGFLLDTSLEPPLCGQTLCDNTEVIASYNQLSSFRQP
KVVRYRVVNLYEDDHKNPTVTREQVDFQHHQLAEAFKQYNISWELDVLEV
SNSSLRRRLILANCDISKIGDENCDPECNHTLTGHDGGDCRHLRHPAFVK
KQHNGVCDMDCNYERFNFDGGECCDPEITNVTQTCFDPDSPHRAYLDVNE
LKNILKLDGSTHLNIFFAKSSEEELAGVATWPWDKEALMHLGGIVLNPSF
YGMPGHTHTMIHEIGHSLGLYHVFRGISEIQSCSDPCMETEPSFETGDLC
NDTNPAPKHKSCGDPGPGNDTCGFHSFFNTPYNNFMSYADDDCTDSFTPN
QVARMHCYLDLVYQGWQPSRKPAPVALAPQVLGHTTDSVTLEWFPPIDGH
FFERELGSACHLCLEGRILVQYASNASSPMPCSPSGHWSPREAEGHPDVE
QPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFLYPLVPESLTIWV
TFVSTDWDSSGAVNDIKLLAVSGKNISLGPQNVFCDVPLTIRLWDVGEEV
YGIQIYTLDEHLEIDAAMLTSTADTPLCLQCKPLKYKVVRDPPLQMDVAS
ILHLNRKFVDMDLNLGSVYQYWVITISGTEESEPSPAVTYIHGSGYCGDG
IIQKDQGEQCDDMNKINGDGCSLFCRQEVSFNCIDEPSRCYFHDGDGVCE
EFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVIIGQPAASQV
CRTKVIDLSEGISQHAWYPCTISYPYSQLAQTTFWLRAYFSQPMVAAAVI
VHLVTDGTYYGDQKQETISVQLLDTKDQSHDLGLHVLSCRNNPLIIPVVH
DLSQPFYHSQAVRVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSP
AEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQI
RRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSC
PEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPP
PVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCT
QDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQG
LGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGS
ECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPA
LIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSC
DLQGDCACRDPQAQEHSRKDLRGYSHG

Кодований геном білок за функціями належить до гідролаз, протеаз, металопротеаз. Білок має сайт для зв'язування з іонами металів, іоном цинку. Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kristensen T., Oxvig C., Sand O., Moller N.P.H., Sottrup-Jensen L. (1994). Amino acid sequence of human pregnancy-associated plasma protein-A derived from cloned cDNA.. Biochemistry 33: 1592 — 1598.  PubMed DOI:10.1021/bi00172a040
  • Oxvig C., Sand O., Kristensen T., Gleich G.J., Sottrup-Jensen L. (1993). Circulating human pregnancy-associated plasma protein-A is disulfide-bridged to the proform of eosinophil major basic protein.. J. Biol. Chem. 268: 12243 — 12246.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8602 (англ.). Архів оригіналу за 6 квітня 2016. Процитовано 8 вересня 2017. 
  4. UniProt, Q13219 (англ.). Архів оригіналу за 16 вересня 2016. Процитовано 8 вересня 2017. 

Див. такожРедагувати