Відкрити головне меню

OPRK1

білок-кодуючий ген Homo Sapiens

OPRK1 (англ. Opioid receptor kappa 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 380 амінокислот, а молекулярна маса — 42 645[5].

OPRK1
4DJH bilayer.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи OPRK1, K-OR-1, KOR, KOR-1, OPRK, opioid receptor kappa 1
Зовнішні ІД OMIM: 165196 MGI: 97439 HomoloGene: 20253 GeneCards: OPRK1
Реагує на сполуку
cebranopadol, Гідрокодон, hydromorphone, pethidine, U50488, enadoline, GR 89696, Налбуфін, nalfurafine, Сальвінорин А, u-69593, tifluadom, beta-endorphin, Буторфанол, DAMGO, dihydromorphine, etonitazene, Фентаніл, levomethadone, Морфін, Налорфін, Пентазоцин, alvimopan, Бупренорфін, diprenorphine, methylnaltrexone, nalmefene, Налоксон, Налтрексон, naltriben, naltrindole, quadazocine, JDTic[1]
Шаблон експресії
PBB GE OPRK1 207553 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001282904
NM_000912
NM_001318497
NM_001204371
NM_011011
NM_001318735
RefSeq (білок)
NP_000903
NP_001269833
NP_001305426
NP_001191300
NP_001305664
NP_035141
Локус (UCSC) Хр. 8: 53.23 – 53.25 Mb Хр. 1: 5.59 – 5.61 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLE
PAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFN
LALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLT
MMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTK
VREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMI
LRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKM
RMERQSTSRVRNTVQDPAYLRDIDGMNKPV

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані.

ЛітератураРедагувати

  • Mansson E., Bare L.A., Yang D. (1994). Isolation of a human kappa opioid receptor cDNA from placenta.. Biochem. Biophys. Res. Commun. 202: 1431 — 1437.  PubMed DOI:10.1006/bbrc.1994.2091
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Li J.-G., Chen C., Liu-Chen L.-Y. (2002). Ezrin-radixin-moesin-binding phosphoprotein-50/Na+/H+ exchanger regulatory factor (EBP50/NHERF) blocks U50,488H-induced down-regulation of the human kappa opioid receptor by enhancing its recycling rate.. J. Biol. Chem. 277: 27545 — 27552.  PubMed DOI:10.1074/jbc.M200058200
  • Li J.G., Chen C., Liu-Chen L.Y. (2007). N-glycosylation of the human kappa opioid receptor enhances its stability but slows its trafficking along the biosynthesis pathway.. Biochemistry 46: 10960 — 10970.  PubMed DOI:10.1021/bi700443j
  • Wang Y.H., Sun J.F., Tao Y.M., Chi Z.Q., Liu J.G. (2010). The role of kappa-opioid receptor activation in mediating antinociception and addiction.. Acta Pharmacol. Sin. 31: 1065 — 1070.  PubMed DOI:10.1038/aps.2010.138
  • Bruchas M.R., Chavkin C. (2010). Kinase cascades and ligand-directed signaling at the kappa opioid receptor.. Psychopharmacology 210: 137 — 147.  PubMed DOI:10.1007/s00213-010-1806-y

ПриміткиРедагувати

Див. такожРедагувати