Відкрити головне меню

NKX2-1 (англ. NK2 homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 371 амінокислот, а молекулярна маса — 38 596[4].

NKX2-1
Protein TITF1 PDB 1ftt.png
Ідентифікатори
Символи NKX2-1, Nkx2-1, AV026640, Nkx2.1, T/EBP, Titf1, Ttf-1, BCH, BHC, NK-2, NKX2A, TEBP, TTF1, NMTC1, NK2 homeobox 1
Зовнішні ІД MGI: 108067 HomoloGene: 2488 GeneCards: NKX2-1
Шаблон експресії
PBB GE TITF1 210673 x at fs.png

PBB GE TITF1 211024 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001079668
NM_003317
NM_001146198
NM_009385
RefSeq (білок)
NP_001073136
NP_003308
NP_001139670
NP_033411
Локус (UCSC) Хр. 14: 36.52 – 36.52 Mb Хр. 12: 56.53 – 56.54 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPT
AAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY
QDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVS
KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHL
TPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQA
QQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA
AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL
NSSGSDYGTMSCSTLLYGRTW

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

ЛітератураРедагувати

  • Oguchi H., Pan Y.-T., Kimura S. (1995). The complete nucleotide sequence of the mouse thyroid-specific enhancer-binding protein (T/EBP) gene: extensive identity of the deduced amino acid sequence with the human protein.. Biochim. Biophys. Acta 1261: 304 — 306.  PubMed DOI:10.1016/0167-4781(95)00033-D
  • Saiardi A., Tassi V., de Filippis V., Civitareale D. (1995). Cloning and sequence analysis of human thyroid transcription factor 1.. Biochim. Biophys. Acta 1261: 307 — 310.  PubMed DOI:10.1016/0167-4781(95)00034-E
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Doyle D.A., Gonzalez I., Thomas B., Scavina M. (2004). Autosomal dominant transmission of congenital hypothyroidism, neonatal respiratory distress, and ataxia caused by a mutation of NKX2-1.. J. Pediatr. 145: 190 — 193.  PubMed DOI:10.1016/j.jpeds.2004.04.011
  • Williamson S., Kirkpatrick M., Greene S., Goudie D. (2014). A novel mutation of NKX2-1 affecting 2 generations with hypothyroidism and choreoathetosis: part of the spectrum of brain-thyroid-lung syndrome.. J. Child Neurol. 29: 666 — 669.  PubMed DOI:10.1177/0883073813518243

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11825 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P43699 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати