MCU

білок-кодуючий ген Homo Sapiens

MCU (англ. Mitochondrial calcium uniporter) – білок, який кодується однойменним геном, розташованим у людей на 10-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 351 амінокислот, а молекулярна маса — 39 867[4].

MCU
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MCU, C10orf42, CCDC109A, mitochondrial calcium uniporter, HsMCU
Зовнішні ІД OMIM: 614197 MGI: 3026965 HomoloGene: 9916 GeneCards: MCU
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001270679
NM_001270680
NM_138357
NM_001033259
RefSeq (білок)
NP_001257608
NP_001257609
NP_612366
NP_001028431
Локус (UCSC) Хр. 10: 72.69 – 72.89 Mb Хр. 10: 59.28 – 59.45 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRT
VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFT
LKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFK
LVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKE
RELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGIL
ARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYL
LFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEK
D

Кодований геном білок за функціями належить до іонних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, транспорт кальцію, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію. Локалізований у мембрані, мітохондрії, внутрішній мембрані мітохондрії.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • De Stefani D., Raffaello A., Teardo E., Szabo I., Rizzuto R. (2011). A forty-kilodalton protein of the inner membrane is the mitochondrial calcium uniporter.. Nature 476: 336 — 340.  PubMed DOI:10.1038/nature10230
  • Drago I., De Stefani D., Rizzuto R., Pozzan T. (2012). Mitochondrial Ca2+ uptake contributes to buffering cytoplasmic Ca2+ peaks in cardiomyocytes.. Proc. Natl. Acad. Sci. U.S.A. 109: 12986 — 12991.  PubMed DOI:10.1073/pnas.1210718109
  • Bick A.G., Calvo S.E., Mootha V.K. (2012). Evolutionary diversity of the mitochondrial calcium uniporter.. Science 336: 886 — 886.  PubMed DOI:10.1126/science.1214977
  • Chaudhuri D., Sancak Y., Mootha V.K., Clapham D.E. (2013). MCU encodes the pore conducting mitochondrial calcium currents.. Elife 2: E00704 — E00704.  PubMed DOI:10.7554/eLife.00704
  • Fieni F., Johnson D.E., Hudmon A., Kirichok Y. (2014). Mitochondrial Ca2+ uniporter and CaMKII in heart.. Nature 513: E1 — E2.  PubMed DOI:10.1038/nature13626

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:23526 (англ.). Архів оригіналу за 25 жовтня 2015. Процитовано 19 вересня 2017. 
  4. UniProt, Q8NE86 (англ.). Архів оригіналу за 17 вересня 2017. Процитовано 19 вересня 2017. 

Див. такожРедагувати