MAPRE1

білок-кодуючий ген Homo Sapiens

MAPRE1 (англ. Microtubule associated protein RP/EB family member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 268 амінокислот, а молекулярна маса — 29 999[4].

MAPRE1
Protein MAPRE1 PDB 1pa7.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MAPRE1, EB1, microtubule associated protein RP/EB family member 1
Зовнішні ІД OMIM: 603108 MGI: 891995 HomoloGene: 56129 GeneCards: MAPRE1
Шаблон експресії
PBB GE MAPRE1 200712 s at fs.png

PBB GE MAPRE1 200713 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012325
NM_007896
RefSeq (білок)
NP_036457
NP_031922
Локус (UCSC) Хр. 20: 32.82 – 32.85 Mb Хр. 2: 153.58 – 153.62 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDM
LFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGK
FQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPK
KPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQV
NVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATD
EGFVIPDEGGPQEEQEEY

Задіяний у таких біологічних процесах як клітинний цикл, поділ клітини, мітоз. Локалізований у цитоплазмі, цитоскелеті.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Berrueta L., Tirnauer J.S., Schuyler S.C., Pellman D., Bierer B.E. (1999). The APC-associated protein EB1 associates with components of the dynactin complex and cytoplasmic dynein intermediate chain.. Curr. Biol. 9: 425 — 428.  PubMed DOI:10.1016/S0960-9822(99)80190-0
  • Nakamura M., Zhen Zhou X., Kishi S., Ping Lu K. (2002). Involvement of the telomeric protein Pin2/TRF1 in the regulation of the mitotic spindle.. FEBS Lett. 514: 193 — 198.  PubMed DOI:10.1016/S0014-5793(02)02363-3
  • Askham J.M., Vaughan K.T., Goodson H.V., Morrison E.E. (2002). Evidence that an interaction between EB1 and p150(Glued) is required for the formation and maintenance of a radial microtubule array anchored at the centrosome.. Mol. Biol. Cell 13: 3627 — 3645.  PubMed DOI:10.1091/mbc.E02-01-0061
  • Bu W., Su L.-K. (2003). Characterization of functional domains of human EB1 family proteins.. J. Biol. Chem. 278: 49721 — 49731.  PubMed DOI:10.1074/jbc.M306194200
  • Lazarus J.E., Moughamian A.J., Tokito M.K., Holzbaur E.L. (2013). Dynactin subunit p150(Glued) is a neuron-specific anti-catastrophe factor.. PLoS Biol. 11: E1001611 — E1001611.  PubMed DOI:10.1371/journal.pbio.1001611

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6890 (англ.). Архів оригіналу за 8 вересня 2015. Процитовано 6 лютого 2017. 
  4. UniProt, Q15691 (англ.). Архів оригіналу за 2 лютого 2017. Процитовано 6 лютого 2017. 

Див. такожРедагувати