Відкрити головне меню

MAP2 (англ. Microtubule associated protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 827 амінокислот, а молекулярна маса — 199 526[4].

MAP2
Ідентифікатори
Символи MAP2, MAP2A, MAP2B, MAP2C, microtubule associated protein 2, MAP-2
Зовнішні ІД MGI: 97175 HomoloGene: 1779 GeneCards: MAP2
Шаблон експресії
PBB GE MAP2 210015 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001039934
NM_008632
NM_001310634
RefSeq (білок)
NP_001035023
NP_001297563
NP_032658
Локус (UCSC) Хр. 2: 209.42 – 209.73 Mb Хр. 1: 66.18 – 66.44 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPY
REDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTA
EAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVTVE
EDLLTASKMEFHDQQELTPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQ
PETTKTYPDKKDMQGTEEEKAPLALFGHTLVASLEDMKQKTEPSLVVPGI
DLPKEPPTPKEQKDWFIEMPTEAKKDEWGLVAPISPGPLTPMREKDVFDD
IPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDK
KSLQQTSGPATAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVE
EHVMGKVLEEEKEAINQETVQQRDTFTPSGQEPILTEKETELKLEEKTTI
SDKEAVPKESKPPKPADEEIGIIQTSTEHTFSEQKDQEPTTDMLKQDSFP
VSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMRVDDKDKIEGV
GAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRE
SVHESIDTMSPMHKNGDKEFQTGKESQPSPPAQEAGYSTLAQSYPSDLPE
EPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSM
SINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATT
PALEKAPCFPVESKEEEQIEKVKATGEESTQAEISCESPFLAKDFYKNGT
VMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVVEDSRTGLPPV
TDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGT
DDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEF
DQEKKANDRLDTVLEKSEEHADSKEHAKKTEEAGDEIETFGLGVTYEQAL
AKDLSIPTDASSEKAEKGLSSVPEIAEVEPSKKVEQGLDFAVQGQLDVKI
SDFGQMASGLNIDDRRATELKLEATQDMTPSSKAPQEADAFMGVESGHMK
EGTKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEHESLTMESLKADEG
KKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLF
RSDTLQITDLGVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTD
EGESGSHSVRFAALEQPEVERRPSPHDEEEFEVEEAAEAQAEPKDGSPEA
PASPEREEVALSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSIM
TEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRISTPERKVAKKEP
STVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
CVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPP
RRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTA
ITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTP
PKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVTKKID
LSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVP
GGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSS
GSINLLESPQLATLAEDVTAALAKQGL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою кальмодуліну. Локалізований у цитоплазмі, цитоскелеті, клітинних відростках.

ЛітератураРедагувати

  • Albala J.S., Kalcheva N., Shafit-Zagardo B. (1993). Characterization of the transcripts encoding two isoforms of human microtubule-associated protein-2 (MAP-2).. Gene 136: 377 — 378.  PubMed DOI:10.1016/0378-1119(93)90502-T
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dammerman M., Yen S.H., Shafit-Zagardo B. (1989). Sequence of a human MAP-2 region sharing epitopes with Alzheimer neurofibrillary tangles.. J. Neurosci. Res. 24: 487 — 495.  PubMed DOI:10.1002/jnr.490240405
  • Kosik K.S., Orecchio L.D., Bakalis S., Duffy L., Neve R.L. (1988). Partial sequence of MAP2 in the region of a shared epitope with Alzheimer neurofibrillary tangles.. J. Neurochem. 51: 587 — 598.  PubMed DOI:10.1111/j.1471-4159.1988.tb01079.x
  • Zamora-Leon S.P., Bresnick A., Backer J.M., Shafit-Zagardo B. (2005). Fyn phosphorylates human MAP-2c on tyrosine 67.. J. Biol. Chem. 280: 1962 — 1970.  PubMed DOI:10.1074/jbc.M411380200

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6839 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P11137 (англ.). Процитовано 28 серпня 2017. 

Див. такожРедагувати