Відкрити головне меню

KRAS (англ. KRAS proto-oncogene, GTPase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 189 амінокислот, а молекулярна маса — 21 656[5].

KRAS
KRAS protein 3GFT.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KRAS, C-K-RAS, CFC2, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS, NS3, RALD, RASK2, K-ras, KRAS proto-oncogene, GTPase, c-Ki-ras2
Зовнішні ІД MGI: 96680 HomoloGene: 37990 GeneCards: KRAS
Реагує на сполуку
lonafarnib[1]
Шаблон експресії
PBB GE KRAS 204010 s at fs.png

PBB GE KRAS 214352 s at fs.png

PBB GE KRAS 204009 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004985
NM_033360
NM_001369786
NM_001369787
NM_021284
RefSeq (білок)
NP_004976
NP_203524
NP_001356715
NP_001356716
NP_004976.2
NP_067259
Локус (UCSC) Хр. 12: 25.2 – 25.25 Mb Хр. 6: 145.22 – 145.25 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQI
KRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQ
RVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM

Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

ЛітератураРедагувати

  • McCoy M.S., Bargmann C.I., Weinberg R.A. (1984). Human colon carcinoma Ki-ras2 oncogene and its corresponding proto-oncogene.. Mol. Cell. Biol. 4: 1577 — 1582.  PubMed DOI:10.1128/MCB.4.8.1577
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yamamoto F., Perucho M. (1984). Activation of a human c-K-ras oncogene.. Nucleic Acids Res. 12: 8873 — 8885.  PubMed DOI:10.1093/nar/12.23.8873
  • Serra R.W., Fang M., Park S.M., Hutchinson L., Green M.R. (2014). A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.. Elife 3: E02313 — E02313.  PubMed DOI:10.7554/eLife.02313
  • Grimmond S.M., Raghavan D., Russell P.J. (1992). Detection of a rare point mutation in Ki-ras of a human bladder cancer xenograft by polymerase chain reaction and direct sequencing.. Urol. Res. 20: 121 — 126.  PubMed DOI:10.1007/BF00296523
  • Sharma M.K., Zehnbauer B.A., Watson M.A., Gutmann D.H. (2005). RAS pathway activation and an oncogenic RAS mutation in sporadic pilocytic astrocytoma.. Neurology 65: 1335 — 1336.  PubMed DOI:10.1212/01.wnl.0000180409.78098.d7

ПриміткиРедагувати

Див. такожРедагувати