IL2 (англ. Interleukin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 153 амінокислот, а молекулярна маса — 17 628[2].

IL2
IL2 Crystal Structure.png
Ідентифікатори
Символи aldesleukinT cell growth factorT-cell growth factorTCGFinvolved in regulation of T-cell clonal expansioninterleukin-2IL2
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE IL2 207849 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINN
YKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHL
RPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIIS
TLT

Кодований геном білок за функціями належить до цитокінів, факторів росту. Задіяний у таких біологічних процесах як адаптивний імунітет, імунітет. Секретований назовні.

ЛітератураРедагувати

  • Fujita T., Takaoka C., Matsui H., Taniguchi T. (1983). Structure of the human interleukin 2 gene.. Proc. Natl. Acad. Sci. U.S.A. 80: 7437 — 7441.  PubMed DOI:10.1073/pnas.80.24.7437
  • Holbrook N.J., Lieber M., Crabtree G.R. (1984). DNA sequence of the 5' flanking region of the human interleukin 2 gene: homologies with adult T-cell leukemia virus.. Nucleic Acids Res. 12: 5005 — 5013.  PubMed DOI:10.1093/nar/12.12.5005
  • Chernicky C.L., Tan H., Burfeind P., Ilan J., Ilan J. (1996). Sequence of interleukin-2 isolated from human placental poly A+ RNA: possible role in maintenance of fetal allograft.. Mol. Reprod. Dev. 43: 180 — 186.  PubMed DOI:10.1002/(SICI)1098-2795(199602)43:2<180::AID-MRD7>3.0.CO;2-N
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Weir M.P., Chaplin M.A., Wallace D.M., Dykes C.W., Hobden A.N. (1988). Structure-activity relationships of recombinant human interleukin 2.. Biochemistry 27: 6883 — 6892.  PubMed DOI:10.1021/bi00418a034
  • Robb R.J., Kutny R.M., Panico M., Morris H.R., Chowdhry V. (1984). Amino acid sequence and post-translational modification of human interleukin 2.. Proc. Natl. Acad. Sci. U.S.A. 81: 6486 — 6490.  PubMed DOI:10.1073/pnas.81.20.6486

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:6001 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, P60568 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати