Відкрити головне меню

Імуноглобулін J (англ. Joining chain of multimeric IgA and IgM) – білок, який кодується геном JCHAIN, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 159 амінокислот, а молекулярна маса — 18 099[4].

Імуноглобулін J
Ідентифікатори
Символи JCHAIN, IGCJ, JCH, IGJ, J chain, joining chain of multimeric IgA and IgM
Зовнішні ІД OMIM: 147790 MGI: 96493 HomoloGene: 16958 GeneCards: JCHAIN
Шаблон експресії
PBB GE IGJ 212592 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_144646
NM_152839
RefSeq (білок)
NP_653247
NP_690052
Локус (UCSC) Хр. 4: 70.66 – 70.68 Mb Хр. 5: 88.52 – 88.53 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSED
PNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVE
LDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETA
LTPDACYPD

Секретований назовні.

ЛітератураРедагувати

  • Mole J.E., Bhown A.S., Bennett J.C. (1977). Primary structure of human J chain: alignment of peptides from chemical and enzymatic hydrolyses.. Biochemistry 16: 3507 — 3513.  PubMed DOI:10.1021/bi00635a002
  • Max E.E., Korsmeyer S.J. (1985). Human J chain gene. Structure and expression in B lymphoid cells.. J. Exp. Med. 161: 832 — 849.  PubMed DOI:10.1084/jem.161.4.832
  • Frutiger S., Hughes G.J., Paquet N., Luethy R., Jaton J.-C. (1992). Disulfide bond assignment in human J chain and its covalent pairing with immunoglobulin M.. Biochemistry 31: 12643 — 12647.  PubMed DOI:10.1021/bi00165a014
  • Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F. (2008). Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.. Proteomics 8: 3833 — 3847.  PubMed DOI:10.1002/pmic.200701057

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5713 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P01591 (англ.). Процитовано 30 січня 2017. 

Див. такожРедагувати