Відкрити головне меню

HSPG2 (англ. Heparan sulfate proteoglycan 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 4 391 амінокислот, а молекулярна маса — 468 830[2].

HSPG2
Ідентифікатори
Символи basement membrane-specific heparan sulfate proteoglycan core proteinPLCHSPG2perlecan proteoglycanPerlecanendorepellin (domain V region)
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE HSPG2 201655 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MGWRAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDIETVTASQMRWTH
SYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQL
EDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELDV
GSEGNADGAQIQEMLLRVISSGSVASYVTSPQGFQFRRLGTVPQFPRACT
EAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVE
TTSLPPRPETTIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPR
DYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDC
EDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDE
FGCMPPQVVTPPRESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSH
PRVTVTSEGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVP
QRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDF
KGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPE
QFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAGYRLLSRGHT
PTQPGALNQRQVQFSEEHWVHESGRPVQRAELLQVLQSLEAVLIQTVYNT
KMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCESCDAHFT
RVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFF
GDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRR
CESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVG
RLCNECADGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEP
GHFSLTNAASTHTTNEGIFSPTPGELGFSSFHRLLSGPYFWSLPSRFLGD
KVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQGNNIILEHHVAQEPSPG
QPSTFIVPFREQAWQRPDGQPATREHLLMALAGIDTLLIRASYAQQPAES
RVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTGYTRTPSG
LYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQR
GTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCA
PGYYGNPSQGQPCQRDSQVPGPIGCNCDPQGSVSSQCDAAGQCQCKAQVE
GLTCSHCRPHHFHLSASNPDGCLPCFCMGITQQCASSAYTRHLISTHFAP
GDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAQLGHESFYWQLP
ETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPA
LQGPERRSYEIMFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSV
PLAASISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQDCAPGYTR
TGSGLYLGHCELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYG
DATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYC
EQCGPGYVGNPSVQGGQCLPETNQAPLVVEVHPARSIVPQGGSHSLRCQV
SGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSDAGVYICTCRN
LHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSP
AYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQ
GTATLHVQASGTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWT
GGPGGQLPAKAQIHGGILRLPAVEPTDQAQYLCRAHSSAGQQVARAVLHV
HGGGGPRVQVSPERTQVHAGRTVRLYCRAAGVPSATITWRKEGGSLPPQA
RSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQVVVLSASDASP
PPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGS
RLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGS
TRPIRIEPSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHG
SLLRLHQVTPADSGEYVCHVVGTSGPLEASVLVTIEASVIPGPIPPVRIE
SSSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIFQ
ASPADAGQYVCRASNGMEASITVTVTGTQGANLAYPAGSTQPIRIEPSSS
QVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSLLRLYQASPA
DSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSQVAE
GQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGE
YVCRVVGSSGTQEASVLVTIQQRLSGSHSQGVAYPVRIESSSASLANGHT
LDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVC
HVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPTVVEGQTLDLN
CVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANN
NIDALEASIVISVSPSAGSPSAPGSSMPIRIESSSSHVAEGETLDLNCVV
PGQAHAQVTWHKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRVMGSSG
PLEASVLVTIEASGSSAVHVPAPGGAPPIRIEPSSSRVAEGQTLDLKCVV
PGQAHAQVTWHKRGGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSSG
TLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQTLDLNCVVPG
QAHAQVTWYKRGGSLPARHQTHGSQLRLHLVSPADSGEYVCRAASGPGPE
QEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAA
PISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGVA
QSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRIS
STPAKLEQRTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEV
IVDTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPAPTIHWSKLRS
PLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPY
ATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELL
HFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIPAGSTP
TVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGHSVQDGV
LRIQNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTV
VVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADA
GQYRCTATNAAGTTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASG
YPTPDISWSKLDGSLPPDSRLENNMLMLPSVRPQDAGTYVCTATNRQGKV
KAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGM
LLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPT
PLALGHFHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYLGG
YPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRD
RPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCV
NRPDGRGYTCRCHLGRSGLRCEEGVTVTTPSLSGAGSYLALPALTNTHHE
LRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLA
VLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGKSQGLNLHT
LLYLGGVEPSVPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIG
QCYDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLR
EPCLHGGTCQGTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPG
QYGAYFHDDGFLAFPGHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEV
GEAGQGKDFISLGLQDGHLVFRYQLGSGEARLVSEDPINDGEWHRVTALR
EGRRGSIQVDGEELVSGRSPGPNVAVNAKGSVYIGGAPDVATLTGGRFSS
GITGCVKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS

Задіяний у такому біологічному процесі як ангіогенез. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у позаклітинному матриксі, базальній мембрані. Також секретований назовні.

ЛітератураРедагувати

  • Kallunki P., Tryggvason K. (1992). Human basement membrane heparan sulfate proteoglycan core protein: a 467-kD protein containing multiple domains resembling elements of the low density lipoprotein receptor, laminin, neural cell adhesion molecules, and epidermal growth factor.. J. Cell Biol. 116: 559 — 571.  PubMed DOI:10.1083/jcb.116.2.559
  • Cohen I.R., Graessel S., Murdoch A.D., Iozzo R.V. (1993). Structural characterization of the complete human perlecan gene and its promoter.. Proc. Natl. Acad. Sci. U.S.A. 90: 10404 — 10408.  PubMed DOI:10.1073/pnas.90.21.10404
  • Mongiat M., Sweeney S.M., San Antonio J.D., Fu J., Iozzo R.V. (2003). Endorepellin, a novel inhibitor of angiogenesis derived from the C terminus of perlecan.. J. Biol. Chem. 278: 4238 — 4249.  PubMed DOI:10.1074/jbc.M210445200
  • Zhang H., Li X.-J., Martin D.B., Aebersold R. (2003). Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.. Nat. Biotechnol. 21: 660 — 666.  PubMed DOI:10.1038/nbt827
  • Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. (2011). Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD.. Mol. Cell. Proteomics: —.  PubMed DOI:10.1074/mcp.M111.013649
  • Murdoch A.D., Dodge G.R., Cohen I., Tuan R.S., Iozzo R.V. (1992). Primary structure of the human heparan sulfate proteoglycan from basement membrane (HSPG2/perlecan). A chimeric molecule with multiple domains homologous to the low density lipoprotein receptor, laminin, neural cell adhesion molecules, and epidermal growth factor.. J. Biol. Chem. 267: 8544 — 8557.  PubMed

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:5273 (англ.). Процитовано 6 лютого 2017. 
  2. UniProt, P98160 (англ.). Процитовано 6 лютого 2017. 

Див. такожРедагувати