HLA-DRB5

білок-кодуючий ген Homo Sapiens

HLA-DRB5 (англ. Major histocompatibility complex, class II, DR beta 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 266 амінокислот, а молекулярна маса — 30 056[4].

HLA-DRB5
1FV1.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HLA-DRB5, HLA-DRB, major histocompatibility complex, class II, DR beta 5, HLA-DRB5*
Зовнішні ІД OMIM: 604776 MGI: 95901 HomoloGene: 101524 GeneCards: HLA-DRB5
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002125
NM_010382
RefSeq (білок)
NP_002116
NP_034512
Локус (UCSC) Хр. 6: 32.52 – 32.53 Mb Хр. 17: 34.31 – 34.32 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGT
ERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
RAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
FYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
KNQKGHSGLHPTGLVS

Задіяний у такому біологічному процесі, як імунітет. Локалізований у клітинній мембрані, мембрані, ендоплазматичному ретикулумі, лізосомі, апараті гольджі, ендосомах.

ЛітератураРедагувати

  • Wu S., Saunders T.L., Bach F.H. (1986). Polymorphism of human Ia antigens generated by reciprocal intergenic exchange between two DR beta loci.. Nature 324: 676 — 679.  PubMed DOI:10.1038/324676a0
  • Lock C.B., So A.K., Welsh K.I., Parkes J.D., Trowsdale J. (1988). MHC class II sequences of an HLA-DR2 narcoleptic.. Immunogenetics 27: 449 — 455.  PubMed DOI:10.1007/BF00364432
  • Demopulos J.T., Hodge T.W., Wooten V., Acton R.T. (1991). A novel DRB1 allele in DR2-positive American blacks.. Hum. Immunol. 30: 41 — 44.  PubMed DOI:10.1016/0198-8859(91)90069-L
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lee B.S.M., Rust N.A., McMichael A.J., McDevitt H.O. (1987). HLA-DR2 subtypes form an additional supertypic family of DR beta alleles.. Proc. Natl. Acad. Sci. U.S.A. 84: 4591 — 4595.  PubMed DOI:10.1073/pnas.84.13.4591
  • Kervaire B., Tiercy J. (1997). Sequence of a new HLA-DR allele, DRB5*0106.. Eur. J. Immunogenet. 24: 225 — 228.  PubMed DOI:10.1111/j.1365-2370.1997.00267.x

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4953 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q30154 (англ.). Процитовано 6 вересня 2017. 

Див. такожРедагувати