Відкрити головне меню

H3F3A

білок-кодуючий ген Homo Sapiens

H3F3A (англ. H3 histone family member 3B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 136 амінокислот, а молекулярна маса — 15 328[4].

H3F3A
Protein H3F3A PDB 1aoi.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи H3-3A, H3.3A, H3F3, H3 histone, family 3A, H3 histone family member 3A, H3.3 histone A, H3F3A
Зовнішні ІД OMIM: 601128 MGI: 1097686 HomoloGene: 134170 GeneCards: H3-3A
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002107
NM_008210
RefSeq (білок)
NP_005315
NP_032237
NP_032236
Локус (UCSC) Хр. 1: 226.06 – 226.07 Mb Хр. 1: 180.8 – 180.81 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALR
EIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі як ацетиляція. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

ЛітератураРедагувати

  • Wells D., Kedes L. (1985). Structure of a human histone cDNA: evidence that basally expressed histone genes have intervening sequences and encode polyadenylylated mRNAs.. Proc. Natl. Acad. Sci. U.S.A. 82: 2834 — 2838.  PubMed DOI:10.1073/pnas.82.9.2834
  • Wells D., Hoffman D., Kedes L. (1987). Unusual structure, evolutionary conservation of non-coding sequences and numerous pseudogenes characterize the human H3.3 histone multigene family.. Nucleic Acids Res. 15: 2871 — 2889.  PubMed DOI:10.1093/nar/15.7.2871
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lachner M., O'Carroll D., Rea S., Mechtler K., Jenuwein T. (2001). Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.. Nature 410: 116 — 120.  PubMed DOI:10.1038/35065132
  • Goto H., Yasui Y., Nigg E.A., Inagaki M. (2002). Aurora-B phosphorylates Histone H3 at serine28 with regard to the mitotic chromosome condensation.. Genes Cells 7: 11 — 17.  PubMed DOI:10.1046/j.1356-9597.2001.00498.x
  • Preuss U., Landsberg G., Scheidtmann K.H. (2003). Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase.. Nucleic Acids Res. 31: 878 — 885.  PubMed DOI:10.1093/nar/gkg176

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4764 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P84243 (англ.). Процитовано 25 серпня 2017. 

Див. такожРедагувати