GNAS

білок-кодуючий ген Homo Sapiens

GNAS (англ. GNAS complex locus) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 245 амінокислот, а молекулярна маса — 28 029[5].

GNAS
Protein GNAS PDB 1azs.png
Ідентифікатори
Символи GNAS, AHO, C20orf45, GNAS1, GPSA, GSA, GSP, NESP, POH, SCG6, SgVI, GNAS complex locus, PITA3
Зовнішні ІД OMIM: 139320 MGI: 95777 HomoloGene: 55534 GeneCards: GNAS
Пов'язані генетичні захворювання
колоректальний рак, Albright's hereditary osteodystrophy, progressive osseous heteroplasia[1]
Шаблон експресії
PBB GE GNAS 200780 x at fs.png

PBB GE GNAS 200981 x at fs.png

PBB GE GNAS 211858 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 20: 58.84 – 58.91 Mb Хр. 2: 174.13 – 174.19 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNA
RAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPEC
LEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPEDDRGPVVP
KHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKD
PRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIPIRRH

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у цитоплазматичних везикулах. Також секретований назовні.

ЛітератураРедагувати

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з GNAS переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:4392 (англ.). Архів оригіналу за 15 травня 2017. Процитовано 12 вересня 2017. 
  5. UniProt, O95467 (англ.). Архів оригіналу за 14 червня 2017. Процитовано 12 вересня 2017. 

Див. такожРедагувати