Відкрити головне меню

FUT1 (англ. Fucosyltransferase 1 (H blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 365 амінокислот, а молекулярна маса — 41 251[4].

FUT1
Ідентифікатори
Символи FUT1, HH, HSC, fucosyltransferase 1 (H blood group), H
Зовнішні ІД OMIM: 211100 MGI: 109375 HomoloGene: 120 GeneCards: FUT1
Шаблон експресії
PBB GE FUT1 206109 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000148
NM_001329877
NM_001271981
NM_008051
RefSeq (білок)
NP_000139
NP_001316806
н/д
Локус (UCSC) Хр. 19: 48.75 – 48.76 Mb Хр. 7: 45.62 – 45.62 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTP
PVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLL
ALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWM
SEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLG
QLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFR
ARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQC
NHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWV
GINADLSPLWTLAKP

Кодований геном білок за функціями належить до трансфераз, глікозилтрансфераз. Локалізований у мембрані, апараті гольджі.

ЛітератураРедагувати

  • Larsen R.D., Ernst L.K., Nair R.P., Lowe J.B. (1990). Molecular cloning, sequence, and expression of a human GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase cDNA that can form the H blood group antigen.. Proc. Natl. Acad. Sci. U.S.A. 87: 6674 — 6678.  PubMed DOI:10.1073/pnas.87.17.6674
  • Wagner F.F., Flegel W.A. (1997). Polymorphism of the h allele and the population frequency of sporadic nonfunctional alleles.. Transfusion 37: 284 — 290.  PubMed DOI:10.1046/j.1537-2995.1997.37397240210.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Koda Y., Soejima M., Johnson P.H., Smart E., Kimura H. (1997). Missense mutation of FUT1 and deletion of FUT2 are responsible for Indian Bombay phenotype of ABO blood group system.. Biochem. Biophys. Res. Commun. 238: 21 — 25.  PubMed DOI:10.1006/bbrc.1997.7232

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4012 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P19526 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати