Відкрити головне меню

FGFRL1 (англ. Fibroblast growth factor receptor like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 504 амінокислот, а молекулярна маса — 54 537[4].

FGFRL1
Ідентифікатори
Символи FGFRL1, FGFR5, FHFR, fibroblast growth factor receptor-like 1, fibroblast growth factor receptor like 1, FGFR-5
Зовнішні ІД MGI: 2150920 HomoloGene: 11067 GeneCards: FGFRL1
Шаблон експресії
PBB GE FGFRL1 gnf1h00389 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001004356
NM_001004358
NM_021923
NM_001370296
NM_001164259
NM_054071
RefSeq (білок)
NP_001004356
NP_001004358
NP_068742
NP_001357225
NP_001004356.1
NP_001157731
NP_473412
Локус (UCSC) Хр. 4: 1.01 – 1.03 Mb Хр. 5: 108.69 – 108.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MTPSPLLLLLLPPLLLGAFPPAAAARGPPKMADKVVPRQVARLGRTVRLQ
CPVEGDPPPLTMWTKDGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCK
ATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFT
QPSKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPR
KKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTG
THPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGG
QKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRS
AFLTVLPDPKPPGPPVASSSSATSLPWPVVIGIPAGAVFILGTLLLWLCQ
AQKKPCTPAPAPPLPGHRPPGTARDRSGDKDLPSLAALSAGPGVGLCEEH
GSPAAPQHLLGPGPVAGPKLYPKLYTDIHTHTHTHSHTHSHVEGKVHQHI
HYQC

Кодований геном білок за функцією належить до рецепторів. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у мембрані.

ЛітератураРедагувати

  • Wiedemann M., Trueb B. (2000). Characterization of a novel protein (FGFRL1) from human cartilage related to FGF receptors.. Genomics 69: 275 — 279.  PubMed DOI:10.1006/geno.2000.6332
  • Kim I., Moon S.-O., Yu K.-H., Kim U.-H., Koh G.Y. (2001). A novel fibroblast growth factor receptor-5 preferentially expressed in the pancreas.. Biochim. Biophys. Acta 1518: 152 — 156.  PubMed DOI:10.1016/S0167-4781(00)00282-7
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504
  • Trueb B., Zhuang L., Taeschler S., Wiedemann M. (2003). Characterization of FGFRL1, a novel fibroblast growth factor (FGF) receptor preferentially expressed in skeletal tissues.. J. Biol. Chem. 278: 33857 — 33865.  PubMed DOI:10.1074/jbc.M300281200

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3693 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q8N441 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати