Фактор елонгації трансляції евкаріот 2

(Перенаправлено з EEF2)

Фактор елонгації трансляції евкаріот 2 (англ. Eukaryotic translation elongation factor 2) – білок, який кодується геном EEF2, розташованим у людей на короткому плечі 19-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 858 амінокислот, а молекулярна маса — 95 338[5].

Фактор елонгації трансляції евкаріот 2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EEF2, EEF-2, EF-2, EF2, SCA26, eukaryotic translation elongation factor 2, Eukaryotic elongation factor 2
Зовнішні ІД OMIM: 130610 MGI: 95288 HomoloGene: 134867 GeneCards: EEF2
Пов'язані генетичні захворювання
spinocerebellar ataxia type 26[1]
Шаблон експресії
PBB GE EEF2 200094 s at fs.png

PBB GE EEF2 204102 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001961
NM_007907
RefSeq (білок)
NP_001952
NP_031933
Локус (UCSC) Хр. 19: 3.98 – 3.99 Mb Хр. 10: 81.18 – 81.18 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASAR
AGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIKQSKDGAGFLI
NLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAER
IKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPM
GNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLGPAERA
KKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKV
FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDAL
LQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISK
MVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRT
ILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFS
VSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAG
ELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIW
CFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGV
RFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQ
CPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADL
RSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPA
LDNFLDKL

Цей білок за функцією належить до факторів елонгації. Задіяний у такому біологічному процесі як біосинтез білка. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у цитоплазмі, ядрі.

Інгібування фактору використовується для лікування бластичної плазмоцитоїдної дендритної клітинної пухлини Таграксофуспом. [6]

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Rapp G., Klaudiny J., Hagendorff G., Luck M.R., Heinz K. (1989). Complete sequence of the coding region of human elongation factor 2 (EF-2) by enzymatic amplification of cDNA from human ovarian granulosa cells.. Biol. Chem. Hoppe-Seyler 370: 1071 — 1075.  PubMed
  • Hanes J., Freudenstein J., Rapp G., Scheit K.H. (1992). Construction of a plasmid containing the complete coding region of human elongation factor 2.. Biol. Chem. Hoppe-Seyler 373: 201 — 204.  PubMed
  • Rapp G., Mucha J., Einspanier R., Luck M., Scheit K.H. (1988). Cloning and sequence analysis of a cDNA from human ovarian granulosa cells encoding the C-terminal part of human elongation factor 2.. Biol. Chem. Hoppe-Seyler 369: 247 — 250.  PubMed

ПриміткиРедагувати

Див. такожРедагувати