Відкрити головне меню

DRD2

білок-кодуючий ген Homo Sapiens

DRD2 (англ. Dopamine receptor D2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 443 амінокислот, а молекулярна маса — 50 619[5].

DRD2
Protein DRD2 PDB 1I15.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DRD2, D2DR, D2R, dopamine receptor D2
Зовнішні ІД OMIM: 126450 MGI: 94924 HomoloGene: 22561 GeneCards: DRD2
Реагує на сполуку
benzquinamide, LP-12, LP-211, LP-44, Ропінірол, Ротиготин, vilazodone, 7-hydroxy-2-(di-N-propylamino)tetralin, Бромокриптин, Дофамін, pergolide, Праміпексол, quinelorane, quinpirole, sumanirole, Апоморфін, aripiprazole, brexpiprazole, Каберголін, lisuride, Пірибедил, roxindole, terguride, Амісульприд, blonanserin, (+)-butaclamol, Хлорпромазин, Клозапін, Домперидон, eticlopride, (Z)-flupentixol, Флуфеназин, Галоперидол, L-741,626, Локсапін, mesoridazine, nafadotride, Оланзапін, perospirone, perphenazine, Пімозид, pipotiazine, Прохлорперазин, promazine, Кветіапін, raclopride, Рисперидон, Сертиндол, Сульпірид, levosulpiride, Трифлуоперазин, Зипразидон, zotepine[1]
Шаблон експресії
PBB GE DRD2 206590 x at fs.png

PBB GE DRD2 216924 s at fs.png

PBB GE DRD2 211624 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016574
NM_000795
NM_010077
RefSeq (білок)
NP_000786
NP_057658
NP_000786.1
NP_034207
Локус (UCSC) Хр. 11: 113.41 – 113.48 Mb Хр. 9: 49.34 – 49.41 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVF
GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEW
KFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR
RVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYV
PFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDM
KLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGK
TRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCD
CNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Selbie L.A., Hayes G., Shine J. (1989). The major dopamine D2 receptor: molecular analysis of the human D2A subtype.. DNA 8: 683 — 689.  PubMed DOI:10.1089/dna.1.1989.8.683
  • Robakis N.K., Mohamadi M., Fu D.Y., Sambamurti K., Refolo L.M. (1990). Human retina D2 receptor cDNAs have multiple polyadenylation sites and differ from a pituitary clone at the 5' non-coding region.. Nucleic Acids Res. 18: 1299 — 1299.  PubMed DOI:10.1093/nar/18.5.1299
  • Dearry A., Falardeau P., Shores C., Caron M.G. (1991). D2 dopamine receptors in the human retina: cloning of cDNA and localization of mRNA.. Cell. Mol. Neurobiol. 11: 437 — 453.  PubMed DOI:10.1007/BF00734808
  • Seeman P., Nam D., Ulpian C., Liu I.S.C., Tallerico T. (2000). New dopamine receptor, D2(Longer), with unique TG splice site, in human brain.. Brain Res. Mol. Brain Res. 76: 132 — 141.  PubMed DOI:10.1016/S0169-328X(99)00343-5
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Binda A.V., Kabbani N., Levenson R. (2005). Regulation of dense core vesicle release from PC12 cells by interaction between the D2 dopamine receptor and calcium-dependent activator protein for secretion (CAPS).. Biochem. Pharmacol. 69: 1451 — 1461.  PubMed DOI:10.1016/j.bcp.2005.02.015

ПриміткиРедагувати

Див. такожРедагувати